KEGG   Bacillus subtilis subsp. subtilis 168: BSU01920
Entry
BSU01920          CDS       T00010                                 

Symbol
skfB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Radical_SAM SPASM Fer4_12 Fer4_14
Other DBs
NCBI-GeneID: 938501
NCBI-ProteinID: NP_388073
Pasteur: BG12714
BSORF: BG12714
UniProt: O31423 A0A6M4JJI5
Structure
Position
214175..215407
AA seq 410 aa
MSYDRVKDFDLPELAVHLQPHGAVMIDRKSMFYFRLSGRGAQLAFLLSKNKNLHKTARIW
EIMKKEEMSADQLKEELSAHPFTEAWTEGLLDQPLHVSGSLDSYLPISCTLQLTNACNLS
CSFCYASSGKPYPEELSSEQWILVMQKLAAHGVADITLTGGEAKLIKGFKELVVVASSLF
TNVNVFSNGLNWRDEEVELLSHLGNVSVQISIDGMDNTHDQLRGRKGGFKESMNTIKKLS
EANIPVIVAMTINESNADEVSDVVEQCANAGAFIFRAGKTLSVGRATEGFKALDIDFEEM
VQIQLREARHKWGDRLNIIDWEHEESSFTTDFCTPGYLAWYIRADGYVTPCQLEDLPLGH
ILEDSMADIGSPARLLQLKCEAKNCKCIGKIELSEPDLPFQKEVKAGIQE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtcatatgatcgtgttaaagattttgatttgccagagttagcggttcatttacagcct
catggtgctgtaatgattgatagaaaaagtatgttttatttcagactcagtggacgtgga
gcacagttggcgtttctgttatcaaaaaacaaaaatcttcataaaacggcacgtatttgg
gagattatgaaaaaagaagagatgagtgctgaccaattaaaagaagagcttagtgcccat
ccatttacggaggcttggacggaagggctgttagatcagcctttacacgtttcgggttcg
ctagattcatatttacctattagttgtaccttacagttgacaaatgcttgtaatttaagc
tgttcgttttgctatgccagctcaggtaaaccatatcctgaggaattatctagtgaacaa
tggatattggttatgcaaaagctagcagcccatggagttgctgatattacgctgaccggg
ggtgaagcaaagctgatcaaagggtttaaagaattagtcgttgttgcaagttcgttgttt
accaatgtgaatgtatttagtaatggattgaactggcgagatgaagaagttgaattactt
agtcacttaggcaatgtttctgtacagattagtattgatggtatggataatacacatgac
caattaagaggcagaaaaggcggctttaaagaaagtatgaataccattaaaaaattatca
gaagcaaacattccagtgattgtcgctatgaccattaatgagtccaatgctgatgaagta
tcagatgtggtggagcaatgtgccaatgcgggtgcttttatctttcgtgcaggaaaaacg
ttatctgttggacgtgcgacagaaggctttaaggctttggatattgattttgaagaaatg
gttcaaatacagcttagggaagcacgtcataaatggggagatcgcctgaacataattgat
tgggagcacgaagagagttcgttcacaacagatttttgtacaccaggatatcttgcttgg
tatataagagcagatggatacgtaactccttgccaattagaagatttgccgctagggcat
attttagaagatagcatggctgacattggttcacctgctcgtttgcttcagttaaaatgt
gaagcaaaaaattgcaaatgtatagggaaaattgagctatctgaaccggacttacctttt
caaaaagaagtcaaggcagggattcaggaatga

DBGET integrated database retrieval system