KEGG   Bacillus subtilis subsp. subtilis 168: BSU01935
Entry
BSU01935          CDS       T00010                                 

Symbol
skfC
Name
(RefSeq) sporulation-killing factor biosynthesis protein SkfC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rce1-like
Other DBs
NCBI-GeneID: 8302931
NCBI-ProteinID: YP_003097671
UniProt: O31425 A0A6M3Z716
Position
215404..216894
AA seq 496 aa
MNSLSLVFWSILAVVGLLLFIKFKPPTIASLLLSKDEAKEISIQFIKEFVGIDVENWDFY
SVYWYDHDTVNKLHHLGILKKNRKVLYDVGLVESWRVRFVHQNQSFVVGVNANREITFFY
ADVPKKTLSGKFEQVSPETLKQRLMASPDGLWSRANMTGTGKKEEDFREVSTYWYIAEAG
DIRLKVTVELQGGRISYIGTEQEILTDQMSKVIRDEQVESTFGVSGMLGSALAMILAILI
LVFMDVQTSIIFSLVLGLLIIICQSLTLKEDIQLTIVNAYDARMSVKTVSLLGILSTLLT
GLLTGFVVFICSLAGNALAGDFGWKTFEQPIVQIFYGIGAGLISLGVTSLLFNLLEKKQY
LRISPELSNRTVFLSGFTFRQGLNMSIQSSIGEEVIYRLLMIPVIWWMSGNILISIIVSS
FLWAVMHQVTGYDPRWIRWLHLFIFGCFLGVLFIKFGFICVLVAHFIHNLVLVCMPLWQF
KLQKHMHHDQPKHTSL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaatagtctatcattggtgttctggagtattttagcagttgttggattactgttattt
attaaattcaaacccccaacaattgcttcactactcttaagcaaagatgaggcaaaagaa
ataagcattcaatttataaaagagtttgttgggatagatgtagagaactgggatttttat
tcagtatattggtatgaccacgatacagtaaataaacttcatcacttaggcatacttaag
aaaaatagaaaggttttatatgatgttgggttggtcgaatcatggagagtccgtttcgtt
caccagaatcaatcatttgtagttggtgtcaatgccaatcgagaaatcacttttttttat
gcggatgttccgaaaaaaaccctttcggggaagtttgaacaagtttctccagagacactc
aagcagaggttaatggcttcacctgatggactttggtctagagcaaatatgactggtact
ggtaaaaaagaggaggattttcgcgaggtcagtacttattggtacatagcggaagcggga
gatattcggctcaaagtgactgttgaattacagggcggccgaatttcttatattggtact
gaacaagaaatactaacagatcaaatgagtaaagtcattcgagatgaacaagtggaatcg
acattcggagtatctggtatgctgggttcagctttagcgatgatccttgcgattctcatc
cttgtatttatggatgtgcaaacaagcataatcttcagtcttgttctgggtttgttgatt
ataatatgccagtcattgacgctgaaagaagatattcaattaacaattgtaaatgcttat
gatgcaagaatgagtgtcaaaacggtcagtttattaggtattttgtctacacttcttaca
ggattattaacaggatttgtagtatttatatgttcattggcaggaaatgcgcttgctggt
gattttggatggaaaacgtttgaacaaccaatagttcagattttctatggaataggagca
gggctcattagtttaggagtgacttctctgctgtttaacttattggagaaaaagcaatat
ttacgaatttcacctgagctttctaaccgaactgtctttctatcaggttttacctttagg
caaggattgaatatgagcatacaaagttcaattggagaagaggtcatctatcggctatta
atgattccagtcatttggtggatgagtggaaatatcctcatctccattattgtatcttcc
tttttatgggcggtgatgcaccaagtaactggatatgacccaaggtggatacgttggctg
catctatttatattcggttgctttctgggagttctcttcatcaaatttggttttatttgt
gtattagtagctcatttcattcataatttagtactcgtctgtatgccgctgtggcagttc
aagcttcagaaacatatgcatcatgatcagccaaagcatacttcactctaa

DBGET integrated database retrieval system