KEGG   Bacillus subtilis subsp. subtilis 168: BSU01950
Entry
BSU01950          CDS       T00010                                 

Symbol
skfE
Name
(RefSeq) SkfA peptide export ATP-binding protein SkfE
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01950 (skfE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU01950 (skfE)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_16 SRP54 RsgA_GTPase AAA_22 AAA_29 AAA_30 DO-GTPase2 AAA_27 TsaE MukB AAA_19
Other DBs
NCBI-GeneID: 938498
NCBI-ProteinID: NP_388077
Pasteur: BG12718
BSORF: BG12718
UniProt: O31427 A0A6M4JC99
Position
216913..217632
AA seq 239 aa
MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDI
LIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEV
HLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTD
QGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcaattgatgcaagtacaaaatttaagcaaatgctatcgaaatggtgatggggttgaa
catttgtctttctcaattcaacgaggagaaatcgtggcgctattggggccaaatggagct
ggaaaaacaacgacaattcgatgtttgacaggtctctataagccggataaaggagatatc
ctcattgagggttctcctccaggagatataaatgttcaaaaaaaagtcgcgcttattcct
gatcagccatatttgtatcccgctttaactgctgctgaacatattcagtttagggcaaga
ggatatcatccaggtaaaaaagatgtaaaagaaagggtttatcatgcattgaaggaagtg
cacttggaggagaaagcaaaccaattgtgtggtcagctgtcaagaggccaaaagcagcgg
gttgtcctggcgggggcgattgttcaagacgctttgctgtatatattagacgaaccgact
gtgggccttgatatcccatcaaaacagtggctctctaactggttaaaaactaaaaccgat
caagggtgttcagcatttgtatcaactcatagtctagagtttgttatagagacagcagac
agggtgatattaattagagacggcaaactcatgcaggatttgtatgttcctcaattcgaa
gaacaagcggaatggagaaaagaagtgattcgtcttctaggggaatggtcagatgaataa

DBGET integrated database retrieval system