KEGG   Bacillus subtilis subsp. subtilis 168: BSU01960
Entry
BSU01960          CDS       T00010                                 

Symbol
skfF
Name
(RefSeq) bacteriocin-SkfA transport system permease SkfF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MCLC
Other DBs
NCBI-GeneID: 938494
NCBI-ProteinID: NP_388078
Pasteur: BG12719
BSORF: BG12719
UniProt: O31428
Position
217697..219040
AA seq 447 aa
MPFLIMLLFVGAIGFQVSFVSRSTTWDMSIAGWVLTGVFILYTAFGLFSNRLPSQMADII
WLYGTATSFSKVVYSVLFFSVTWKALLWIISAIFGDVLIVLLSGDHINLLGRSIIFVGLF
FIAEVWLMSVSCARTVKKMKRVYVLVFLLMLGIYSICLYRFFFLQHSSGIWESIARFISG
VGLVFDTLSPLYVVVFIGIITVSFMTIAFTSRQVEMKESLVKEAEFWEEFQERQFGSGQI
IQKPKTTWWGLQGLNGIWSFLWLELLLFKKYLFFHSIHTVMLSGVFYVVIFMYPEWFYLL
FFLIVSAVMLSSYYSGIVRHSQSGTLHLFPGALWKKIIILELTNTVWLYILYCVSITFMA
VGNLVYWYIYGLGIYIWFMTIRLFAFTHTNRNDIKLSLPQYYKSFFMALGLSGICLYVIH
LLTADWYTLVVVVCIGSLSWCLFYRFR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgccttttttgatcatgctcctttttgttggggccatcggatttcaagtaagttttgtt
tctagatctacgacatgggatatgagtattgctggttgggtacttacaggtgtttttatc
ctttatacggcatttggacttttttcaaatcgattaccaagtcaaatggcagatattata
tggctttatggcactgccacatctttttcaaaagttgtgtatagtgttttatttttcagc
gtcacttggaaggcgttgctttggatcatctcagccatattcggtgatgtattaattgtg
cttctgtctggtgatcatatcaatttattaggccgatccataatttttgtagggctcttt
tttatcgctgaagtgtggttgatgtcggtctcttgtgccagaacagtgaagaaaatgaaa
agggtatacgttttagtctttcttctaatgttaggcatttactccatatgtctttatcgc
ttcttctttctccaacattcatctgggatatgggagagcattgcccgttttattagtggc
gttggattagtgtttgatacattgtcaccgttgtatgtggttgtatttattgggattatc
acagtctcttttatgacaattgcttttacgagccgtcaggtagaaatgaaggaatcgttg
gtgaaagaagctgaattctgggaggaatttcaagaacgtcaatttggttcaggtcaaatt
atacagaaaccaaaaacgacttggtggggcttgcaaggtctaaatggcatttggtctttt
ctgtggttggaactgttgctttttaaaaaatatttattttttcatagcattcatacggtc
atgctcagtggcgtcttttatgtcgtcattttcatgtatccagaatggttttatcttcta
ttctttcttatcgtctcggcagtcatgttaagttcctattattcaggaattgtcagacat
tctcaatcaggcacccttcatttattccccggtgccctttggaaaaaaatcattattcta
gagctgacgaatacagtctggttgtatattctttactgtgtttctattacttttatggca
gttgggaatttagtttattggtatatatatggcttagggatatatatatggttcatgaca
ataaggctttttgcttttacccatacaaaccgaaacgatattaagctttcattgcctcaa
tactacaagtcattttttatggcattaggcctgagcggcatttgtttgtatgtcattcat
ttattgactgctgactggtatacattagtggtggtcgtctgcatagggagcctaagttgg
tgcctgttttatcgtttcagatag

DBGET integrated database retrieval system