KEGG   Bacillus subtilis subsp. subtilis 168: BSU01970
Entry
BSU01970          CDS       T00010                                 

Symbol
skfG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HEAT_2 HEAT_PBS
Other DBs
NCBI-GeneID: 938502
NCBI-ProteinID: NP_388079
Pasteur: BG12720
BSORF: BG12720
UniProt: O31429 A0A6M3ZA15
Position
219087..219602
AA seq 171 aa
MNSNGDKLSLSVQNLANTNEITIVQAIGELKKSGKDAIPVLVEALKEEGSLCNIAAAVLG
EFGEDASEAAEELSCLLKSHAEDTRMAAAISLMRIGKPSLPFVIKIAQESEGQSCFWASW
CIAWIDPSCIEPKMYKCLKYEHEHPSGIVAPFAAEEALGKLIAFQLKDKED
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaattcaaatggtgataaattgtcgttatctgttcagaatttagcgaatacaaatgag
atcacaattgttcaagcgataggtgagctaaagaaatcgggaaaagatgcaataccagtt
ttggttgaggccttaaaagaggaaggctctttgtgtaatattgctgcagctgttttaggt
gagtttggggaagacgcgagtgaagcagcggaggagctatcatgtttattaaaaagtcat
gcggaagatacaagaatggcagcggcgatttcattaatgagaatcgggaagcccagtctg
ccctttgtcatcaaaatcgctcaagaaagtgaagggcaatcgtgcttttgggcatcttgg
tgtattgcatggattgatccgtcttgcattgaacctaagatgtataaatgtctaaaatac
gagcatgaacatccttcaggaatagttgctccgtttgcggctgaagaggcattaggaaag
ctgattgcttttcagctgaaagataaggaggactga

DBGET integrated database retrieval system