KEGG   Bacillus subtilis subsp. subtilis 168: BSU01980
Entry
BSU01980          CDS       T00010                                 

Symbol
skfH
Name
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Thioredoxin_8 Thioredoxin_2 AhpC-TSA Redoxin Thioredoxin APOBEC2 MCR
Other DBs
NCBI-GeneID: 938499
NCBI-ProteinID: NP_388080
Pasteur: BG12721
BSORF: BG12721
UniProt: O31430 A0A6M4JEY7
Position
219607..220032
AA seq 141 aa
MKDEQMLTEWPSHLPWLNQSQNDFTFPSDTYLLLYFWSMSCPNCHQLTDKVLQDIKDMNV
KVIGVHVPYIEEEKSMEVVLTYALDRGLAIPIVLDQNYEIVTTCHVQGIPSFCLLSQYGQ
IITKTMGDVGWDKMLKKIAGL
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaaagatgaacaaatgttgactgaatggccaagtcatttaccatggttgaatcaatca
cagaatgattttacatttccaagtgacacatatcttcttctttatttttggtcaatgagc
tgtccaaactgtcaccaattaacagacaaagtccttcaagatataaaggatatgaatgtg
aaagtaatcggagtacatgtcccctatatagaagaagagaaatctatggaggttgtcttg
acgtatgctcttgataggggactagctattccgattgtattagaccaaaactatgagatc
gtcacaacttgtcacgtacaaggcatccccagcttttgtctattaagtcaatacggtcag
atcattactaaaacgatgggagatgttggttgggataagatgttaaaaaagattgcaggc
ttgtga

DBGET integrated database retrieval system