KEGG   Bacillus subtilis subsp. subtilis 168: BSU02000
Entry
BSU02000          CDS       T00010                                 

Symbol
ybdJ
Name
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02000 (ybdJ)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU02000 (ybdJ)
SSDB
Motif
Pfam: Response_reg Trans_reg_C OKR_DC_1_N
Other DBs
NCBI-GeneID: 938485
NCBI-ProteinID: NP_388082
Pasteur: BG12723
BSORF: BG12723
UniProt: O31432 A0A6M3Z7F9
Position
221258..221929
AA seq 223 aa
MKGYRILIVEDDVMIGDLLQKILQREGYRVIWKTDGADVLSVIQKVDLVIMDVMLPGEDG
YQMSAKIKKLGLGIPVIFLSARNDMDSKLQGLQIGEDYMVKPFDPRELLLRMRNMLEHHY
GTFTQIKHLYIDAVTKKVFNESLHDEVLFTAIERKIFFYLYENRDSILTKEHFFEYLWQL
EDRNPNIVNVHIKKIRAKINDQAGEMIENIYGEGYRLNTVVKK
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaagggttatcgtattttaatcgttgaggacgatgtgatgattggtgatttgctgcaa
aagattttgcagcgcgagggatatcgtgtgatatggaaaacagatggagcggatgtgctt
tcggtgattcagaaggtggatttggtcattatggatgtgatgctgccgggtgaagacggg
tatcaaatgtctgcaaaaatcaaaaagctggggctgggcattccggttatttttctctca
gcccgcaatgacatggacagcaagcttcaaggtttgcagatcggcgaggattatatggta
aagccctttgatccgagagagctgctattaagaatgcggaatatgcttgagcatcattat
gggacctttacgcaaatcaaacatttgtatattgatgcggtaacgaaaaaagtgttcaat
gaaagcctgcatgatgaggtattatttactgcgattgagcggaaaattttcttttattta
tatgaaaatagagacagtatcctgacaaaggaacatttctttgaatatctatggcagctc
gaagatagaaacccgaatattgtcaatgtgcatattaaaaaaattagagctaaaatcaat
gatcaagcgggtgagatgattgaaaatatatatggagaagggtatcggctgaataccgtt
gtgaagaaatga

DBGET integrated database retrieval system