KEGG   Bacillus subtilis subsp. subtilis 168: BSU02010
Entry
BSU02010          CDS       T00010                                 

Symbol
ybdK
Name
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HisKA HAMP HATPase_c
Other DBs
NCBI-GeneID: 938496
NCBI-ProteinID: NP_388083
Pasteur: BG12724
BSORF: BG12724
UniProt: O31433
Position
221950..222912
AA seq 320 aa
MLLFTAVISVPMLLLAVSVLMSVIYDSMFKPMNHGMPFHRSFAYPAMIVVFLISLLLLAF
LFSKSIHSLLHKINLLNQTIRHLASDQRVPDKIEVKRADEIGELIKSVNLLIERTTYREL
ELRQQEEIKKELLQKLRHDINTPLTALRLQLFYLEDQCHGQAVFESLYQQIEYISELTNE
FNLYSAETLESSYIVNEEVRLNELLETAVKKWDYLYSMSGIELHYKPADQDVIWMSNTLW
MERLFDNIFQNTLRHSKAKKMEVTIEHGDVFIRDDGIGFDRNESSEGLGLKIIEDTCRLL
AITYELHTNDNGTGFLFSKE
NT seq 963 nt   +upstreamnt  +downstreamnt
ttgttattgtttacggccgtcattagtgttccgatgctattgctggcggtcagtgttttg
atgtcggtgatttatgacagcatgtttaaaccgatgaatcatggtatgccctttcacagg
tcgtttgcatacccggcaatgatcgttgtatttttgatatcactcttattgttagctttt
ttattttcaaagtcgattcattctctgttgcataaaatcaatctattaaatcaaaccatt
cggcatttggcgagtgatcaaagggtgcccgataaaattgaagtgaagcgtgctgatgaa
atcggggaactgatcaagtcggtcaatttgttaattgaacggacgacatatcgtgaactg
gagctgagacagcaggaggaaatcaaaaaggagcttttgcaaaaactgcggcatgacatt
aatacacctttaacggctctcaggctgcagttattttatttggaagaccaatgtcatggt
caggctgtattcgaatcattgtatcagcaaatcgaatatatctcggaattaactaatgaa
ttcaatctatattccgctgagacgctggaaagctcttatattgtaaatgaagaagtgcgt
ctaaacgagctattagaaacagcggtgaaaaagtgggattatttatacagtatgagtggg
attgagctgcactataagccggcagatcaagatgtgatatggatgagcaacacgttatgg
atggaaaggctgtttgataatatttttcaaaatacgttaaggcattcaaaagctaaaaag
atggaagtcacgattgaacatggcgatgtttttattcgtgatgacggtattggatttgat
cggaatgagagcagtgagggacttgggttaaagattattgaggatacatgcaggctgctt
gcgattacttatgagctgcatacaaatgataacggaacggggttcttgttttcaaaagag
tga

DBGET integrated database retrieval system