KEGG   Bacillus subtilis subsp. subtilis 168: BSU02040
Entry
BSU02040          CDS       T00010                                 

Symbol
ybdN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_23
Other DBs
NCBI-GeneID: 938489
NCBI-ProteinID: NP_388086
Pasteur: BG12727
BSORF: BG12727
UniProt: O31436 A0A6M3Z727
Position
complement(224075..224932)
AA seq 285 aa
MVKKWLIQFAVMLSVLSTFTYSASAVGVTAITGNNSFDTAMPIGYWKYKNIDTTILEAGQ
DEAYFTFTANKGEKVYMRSTYQSAYTGMKIEIYDKNRIPVSQGTEVINPNTFSSFIYANA
DAQNTTDTFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSGVAENKGNTSLSPSGSDS
SVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHLIMTSENNEWSRALVNSSTSGSY
DISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDVTKQF
NT seq 858 nt   +upstreamnt  +downstreamnt
atggtgaaaaaatggcttattcaattcgctgttatgctttctgtcttatctacctttacg
tattcggcatcagctgtcggagtcactgctatcacaggaaacaattcatttgataccgca
atgccgatcggttattggaaatataaaaatatcgatacaacaatactggaagctggtcaa
gatgaagcctatttcacttttacggctaataagggagaaaaagtatacatgaggagtaca
taccagagcgcgtatacagggatgaaaattgaaatttatgacaagaacagaatacctgtt
tctcaagggacagaagttattaaccctaatacgttttcttcttttatttatgcaaatgca
gacgcccaaaacacgacggataccttctatgtgaaagtgtcacgaggcacctatactgga
aacatgtactttacgctttcaattgaagaccgaatcaaatcaggcagcggaacgttccaa
ttcagcggcgttgctgaaaataaaggaaatacaagccttagcccctcaggttctgactcc
agcgtgatcaaggttgatttaacaaaccaatctgggataccgcgtgatgccattgtaacc
agagttcaaacaaccgccactcaaacaccaagccagggaaatacacgccatctgatcatg
acaagcgaaaataacgaatggagccgtgcccttgtaaacagctcgacttcagggtcttat
gatatctctttgtcggatcaactcagtgtggcaaaggtatggagttttaaatataataca
ttagcgacagccagatcgacgatgagcaacgtaaaagcaaaaatagattatgaatacgac
gtgacaaagcagttttaa

DBGET integrated database retrieval system