KEGG   Bacillus subtilis subsp. subtilis 168: BSU02050
Entry
BSU02050          CDS       T00010                                 

Symbol
ybdO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4885
Other DBs
NCBI-GeneID: 938493
NCBI-ProteinID: NP_388087
Pasteur: BG12728
BSORF: BG12728
UniProt: O31437 A0A6M3Z6W3
Position
225064..226248
AA seq 394 aa
MRLNRQFIRTQLIAQNILSKNAPAKRENATENPAAVLEKAYSRLKSQSSTGGINQFNYSK
TSVSGNSGTFSKVYQSANDRTVTDTGEETVIQSQNPYESESDIRIKILDEKYSRMNAINK
TKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFKGKAQNYNLQDAVFRNVT
FHGEVEAENEKVYQRGQVNQQLQVLLNRNHIHIPEGTELTFTITPIDYQVRVSGTDDQDL
IKQIEQVLQSGDNSKELFLHIMKSQSSDSAQFSEEAYKKYQAAREMYEVTGYHLKDLEVI
DGRYVTPEGRDLMDVYKEELEKDPVQKQTASYAISYYRSELSKIAEAGYNAIPDFILSID
YSNGSLRDVGQSKSYGTGDTGWLEALKRQTGVNY
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcgtctgaatcggcaatttatccgcactcagctgattgcacagaacatattgagcaag
aatgcgcctgccaaacgggagaatgcgactgaaaatccagcggcagttctggaaaaggca
tatagcaggcttaagtcacaatcttcaactgggggaatcaatcagttcaattattctaaa
accagcgtgtcgggaaacagcgggacgttcagcaaagtgtatcaatcagcgaatgatcga
acagtgacagacacaggggaagaaacagtgattcaatcccaaaacccctatgaatctgag
agtgatatcagaatcaaaatactagatgaaaaatacagcaggatgaatgcgattaataaa
acaaagtctgatccattaggctatattaaggataagtaccaaaattcaaagtctccttat
ttcagaagtgatctgtcagctgcagaaagacaggccgcttacgataatgaaacagaatgg
ttattcaaagggaaggcgcaaaactataaccttcaggatgctgtgtttcggaatgtcaca
tttcatggggaagtggaagctgagaatgaaaaggtgtatcagcggggacaggttaaccag
cagctgcaagtactgttgaatcgaaaccatattcatattccagaggggacagagctgacg
tttacaatcacaccgattgactatcaggtgcgggtaagcgggacagacgatcaggatctg
atcaagcaaattgagcaagtgctgcaatctggagacaacagcaaagaactatttttacac
atcatgaaaagtcaaagcagtgattcagcacaattttccgaagaggcctataaaaagtat
caggcagctcgtgagatgtatgaagttacaggctaccatttgaaggatttagaagtgatt
gatgggcggtacgtcacgcctgagggacgtgacttaatggatgtatataaggaagagctt
gaaaaagatccagtgcagaaacaaacggcttcttatgctatatcttactatcgttcagag
ctcagtaaaatcgcggaagccgggtataatgccattccggatttcatcctatcaattgat
tacagcaatggatctctgagagatgtgggacaaagcaagagctatgggaccggagatacc
gggtggcttgaagcattaaagcgtcaaacgggtgtgaattattag

DBGET integrated database retrieval system