KEGG   Bacillus subtilis subsp. subtilis 168: BSU02060
Entry
BSU02060          CDS       T00010                                 

Symbol
ybxG
Name
(RefSeq) transporter
  KO
K03293  amino acid transporter, AAT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU02060 (ybxG)
SSDB
Motif
Pfam: AA_permease AA_permease_2 Insulin_TMD
Other DBs
NCBI-GeneID: 938470
NCBI-ProteinID: NP_388088
Pasteur: BG11505
BSORF: BG11505
UniProt: P54425 A0A6M3Z6T7
Position
226566..227954
AA seq 462 aa
MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLLAYAICGIFIFFIMRA
MGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMSEIIAVGSYTKYWFPDL
PAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMIIAGIGIIFFGFGNGGDA
IGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAGEAKDPQNTLRNAIQSIIW
RILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAAAGIINFVVITAAMSGCNSG
IFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIGLAVGVVLNYIAPPKIFVYVY
SASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFAPFTNYLTIAFLLMVLVGMWFN
DDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSEQAAE
NT seq 1389 nt   +upstreamnt  +downstreamnt
gtggcaaataaagaattaaagaggggcctgggcgcgcgccatattcagatgatcgccttg
ggcggtacaatcggtgttggcttgtttatgggttctgccagcacgatttcatggactggc
ccatctgtccttctggcttatgcaatatgcggaatttttatcttttttattatgcgtgcg
atgggtgaaatgctgtatgtcgagccgagcacaggttcttttgcgacgttcggccatcaa
tatattcatccgatggcaggttatataacagcatggagcaactggttccagtggattatc
gtcggcatgtcagaaattatcgctgtcggttcttatacgaagtattggttcccggatttg
cctgcttggatacctggtatcgtggcaatggtgattcttggtgcggcgaatttaatttct
gttaagtcgtttggggaatttgagttttggtttgcgatgattaaaatcgtgacgattatc
ttgatgattattgcgggaatcggaattattttcttcggttttggcaatggcggagatgcg
atcggtttgtcgaacctgtggtctcacgggggcttctttgcaggaggtttctcaggtttc
ttctttgcactgtctcttgtcattgcagcctatcaaggagttgagctgatcgggattaca
gcgggtgaagcgaaggacccgcaaaacacgctaagaaatgcgattcaaagtattatctgg
cgtattttgattttctacattggcgctatttttgtgatcgtgacggtgtatccttgggat
gagctcaactcactcggaagtccgtttgtgtctacgttctcgaaaattggaattacggca
gcggccggcattattaactttgtcgtgattactgcggcaatgtccggctgtaacagcggt
attttcagcgcgggccgcatgctgtatacactgggtgtcaatggacaagcaccgaaattc
tttaagaagatttcacgcaatggtgtgccgctgtatggcacaattgcggtgctgatcggt
ttggctgtcggcgttgtactgaactatatcgcgccgccgaagatctttgtctatgtatac
agcgcaagcgtgctcccagggatgattccttggtttatcattttgatcagccatatcgga
ttcagaaaagcgaagggtgctgcattagataaacatccattcaaaatgccgtttgctcct
tttacaaactatttgacgattgctttcttgctgatggttctggttggcatgtggtttaac
gatgatactcgtatctccctgattgtaggcgtgattttcttagcgcttgtggtcattagt
tattatgtgtttgggattggcaaacgcacgcaggccaatttgacaaaaagcgaacaagca
gctgaataa

DBGET integrated database retrieval system