KEGG   Bacillus subtilis subsp. subtilis 168: BSU02080
Entry
BSU02080          CDS       T00010                                 

Symbol
ybxH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5370
Other DBs
NCBI-GeneID: 938445
NCBI-ProteinID: NP_388090
Pasteur: BG11506
BSORF: BG11506
UniProt: P54426 A0A6M3Z772
Position
228331..228522
AA seq 63 aa
MGAIERSGYTFQPEFSVVRQNGAIHVYHQGEFVEEIEFEFNGEYPDHDLIEELVNHYCFE
HEI
NT seq 192 nt   +upstreamnt  +downstreamnt
atgggagcaattgaacgaagcggatatacatttcagccggagtttagcgttgtccgtcaa
aacggagccatccatgtgtaccatcaaggagaatttgtggaagaaatcgaatttgaattt
aacggggaatatcccgatcatgatttgattgaagagcttgtgaatcattattgttttgag
catgagatttag

DBGET integrated database retrieval system