KEGG   Bacillus subtilis subsp. subtilis 168: BSU02090
Entry
BSU02090          CDS       T00010                                 

Symbol
ybxI
Name
(RefSeq) beta-lactamase YbxI
  KO
K17838  beta-lactamase class D [EC:3.5.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU02090 (ybxI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BSU02090 (ybxI)
SSDB
Motif
Pfam: Transpeptidase Bac_export_2 PfkB
Other DBs
NCBI-GeneID: 938466
NCBI-ProteinID: NP_388091
Pasteur: BG11507
BSORF: BG11507
UniProt: P54427 A0A6M3ZC62
Structure
Position
complement(228549..229352)
AA seq 267 aa
MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQT
FVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSA
MRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLE
KLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVF
VTNVDDSGTKAKNITVDILKKYGLITS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaaaaaatggatatatgttgtgcttgtgctgagtattgcagggatcggcggcttctcc
gtccacgcagcatcatctgctcatgaaaaacacttgaatgtcagcaaaatgaatgtcgat
gatgaattcaaggatacggatggaaccttcattcttcacgatttacaaaaggatcagaca
tttgtctataacagaaaacgggcaaatcaaagacaaactccgcaatccacctttaaagtc
gtgaacgctttaatcggtttgcaggtcaaagctgtaagagatgaatacgatgttaaacga
tgggacggggtcaagcgtgaattcgaatcatggaaccgcgaccatacgcttggctcggcc
atgcgcgaatccgcaatctggtattatcaggcattagcgagagatatcggcgaggaaaga
atgaaaacatggcttcatactctatcttacggcaacgaggatatcagcgggggaatcgac
cagttttggctgcaaagctcgctcacaatatctccgctggaacaagaaacttttttggag
aaactggctaaagaggagcttccatttgacaagccggtgatgaaaatcgtcaagcgcatg
atgattcaagaggaaggcgatcattacacgctctacgggaaaaccggaacccgcctgact
gatatgggattaggatggtttgtcggattcatcaaaacagagcatggctcttatgtcttt
gtcaccaatgtcgatgattccggcacaaaagccaaaaacatcaccgtggatatcctgaaa
aagtatggcctgattacatcctaa

DBGET integrated database retrieval system