KEGG   Bacillus subtilis subsp. subtilis 168: BSU02110
Entry
BSU02110          CDS       T00010                                 

Symbol
ybyB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PhrC_PhrF
Other DBs
NCBI-GeneID: 938450
NCBI-ProteinID: NP_388093
Pasteur: BG12754
BSORF: BG12754
UniProt: O31441 A0A6M3Z7E9
Position
complement(230819..231079)
AA seq 86 aa
MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQPDMETFPVDKAGHPD
PQDIEDNKMVSEGSMYPVQYYDEKKK
NT seq 261 nt   +upstreamnt  +downstreamnt
atgaaacaaaagctgttactttcaggtctcgctgtttcaactgtcggcatcacttcttat
ctattaaaagacccgtcaaatcgccaaaaggcaagagaattcattcacagcatgaagatg
aaaataacaaaacagccagacatggaaacgttcccagttgataaagccggccacccggac
ccgcaagatatcgaggacaacaaaatggtatcagaaggctccatgtatcccgtccaatac
tacgatgaaaaaaagaagtaa

DBGET integrated database retrieval system