KEGG   Bacillus subtilis subsp. subtilis 168: BSU02140
Entry
BSU02140          CDS       T00010                                 

Symbol
glpT
Name
(RefSeq) glycerol-3-phosphate transporter
  KO
K02445  MFS transporter, OPA family, glycerol-3-phosphate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02140 (glpT)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    BSU02140 (glpT)
SSDB
Motif
Pfam: MFS_1 Nuc_H_symport FixQ
Other DBs
NCBI-GeneID: 938447
NCBI-ProteinID: NP_388096
Pasteur: BG10645
BSORF: BG10645
UniProt: P37948 A0A6M4JI19
Position
complement(233994..235328)
AA seq 444 aa
MLNIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLRKNFAFAIPYLQEQGF
SKTELGLVLAAVSIAYGFSKFIMGMVSDRCNPRYFLATGLFLSAIVNILFVSMPWVTSSV
TIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIWNVAHNIGGGILAPLVTLGI
AMFVTWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEEYRNDYPKHAFKNQEKELT
TKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLTEAKGFSPEDSRWSYFLYEY
AGIPGTILCGWISDRFFKSRRAPAGVLFMAGVFIAVLVYWLNPAGNPLVDNIALISIGFL
IYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAFANAIMGFVVDRFNWNGGFIML
ISSCILAIVFLALTWNTGKRAEHV
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcttaatatatttaaaccggctcctcatattgagagactggatgattcaaagatggat
gcggcatacaaacggctcagactgcaagtattcattggtattttcattggctacgcaggc
tactacctgctgcggaaaaactttgcctttgccattccttatctgcaggaacagggattt
tcgaaaacagaactgggtttggtgctggccgctgtgtccattgcgtacggcttcagcaaa
ttcatcatgggaatggtgtctgaccgctgtaatccgagatattttctggcgacaggccta
tttttatcagcaatcgttaatattctattcgtttcaatgccttgggtgacttcgagcgtc
accatcatgtttatttttatgtttatcaacggatggtttcaaggaatgggctggccgcca
tgcggcaggacgatggcccattggttctccataagtgaacgcggcacaaaaatgtcgatc
tggaatgtcgcccataacataggcggcggtattcttgctccgcttgtcactcttgggatc
gcgatgttcgtcacttggaaaagcgtgtttttcttccctgccatcatcgccattatcatt
tcatttttaattgttttattggttcgtgatacgcctcaatcctgcggactcccgccaatt
gaagagtatcggaatgactatccaaaacacgcttttaaaaatcaggaaaaagaattaaca
acaaaagaaattctttttcaatatgtgctgaacaacaaatttctttggtacatcgctttt
gccaatgtatttgtttatttcgtgcgatacggcgtggttgactgggcgcctacttactta
acagaagccaaaggcttttctcctgaagactcacgctggtcgtattttctttacgaatac
gcaggcataccgggaacgatcttgtgcggctggatcagtgaccgattcttcaaaagccgc
cgggcaccggcaggcgttttgtttatggcgggtgttttcattgccgtattggtgtactgg
ctgaatccggccggcaatccgctcgtggacaatatcgccctgatcagcattggcttctta
atctacggacctgttatgctgatcggccttcaagcaattgacctagcaccgaaaaaagca
gccggaactgcagccggtttgaccggatttttcggatacatcggcggatccgccttcgca
aacgccattatgggctttgtcgtggaccgttttaactggaacggcggctttatcatgctg
atctcatcctgcattcttgccatcgtcttcttggctttgacgtggaatacaggaaaacgg
gcagagcatgtttaa

DBGET integrated database retrieval system