KEGG   Bacillus subtilis subsp. subtilis 168: BSU02150
Entry
BSU02150          CDS       T00010                                 

Symbol
ybeF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2651 RseC_MucC Pox_P21 DUF2070
Other DBs
NCBI-GeneID: 938444
NCBI-ProteinID: NP_388097
Pasteur: BG12731
BSORF: BG12731
UniProt: O31442 A0A6M4JCB8
Position
235625..235873
AA seq 82 aa
MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYS
LVSLALSYITLIVVRKRKESGN
NT seq 249 nt   +upstreamnt  +downstreamnt
atggatgaattagatatcgcattctttattttaccgttaggaattatgctgctatcgatt
gtcgggacctgtatttgtaaaaacccgtatctgatgccaatgcttagtttggtgatttct
cttgtgctcacctttaccatttttaatcaatcatttttgggatgggctgttgtctatagc
ttggtttctctggctttatcctatatcacattgattgtggtaaggaaaaggaaggaatca
ggaaattaa

DBGET integrated database retrieval system