KEGG   Bacillus subtilis subsp. subtilis 168: BSU02160
Entry
BSU02160          CDS       T00010                                 

Symbol
ybfA
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 MarR Acetyltransf_10 Acetyltransf_7 MarR_2 HTH_24 FR47 Acetyltransf_9 Acetyltransf_3 TrmB Acetyltransf_8 Acetyltransf_CG Binary_toxB_3 Acetyltransf_6 MqsR_toxin HTH_27 HTH_Crp_2
Other DBs
NCBI-GeneID: 938439
NCBI-ProteinID: NP_388098
Pasteur: BG12732
BSORF: BG12732
UniProt: O31443 A0A6M3Z6U8
Position
235965..236882
AA seq 305 aa
MKTRESSVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFEIYNTPNCTAKALQDK
LGLDRGYVSRIVKQFEKEDLIYKQRSKDDARHHYIFVTETGKTIYKKLEEKANEQVELML
KVINQKEQHKLAEAMAEIEAILSQSLSARASEISIRDYFLSEDLQLLIEKQRQFYAEAHG
WDDTFLAYLQETFDADIEKIWIAESGGKFAGSVGLVKHDEKTVQLRWFLVDADFRGRGLG
TQLLEHLVAYCQDMKFDRIFLWTVSTMAEARPLYKKFGFRISEVKQEAPLWGQQLTEERW
DLELS
NT seq 918 nt   +upstreamnt  +downstreamnt
ttgaaaacaagagaatcatctgtcgggttaaaattcagaaagttcaatcgattttataca
aacgtccttggtttccttaatgagcacatttacgacagcccgttttccttaacagaaaca
cggattttatttgagatttataatacgcctaattgtacggcaaaagctcttcaggataag
ctggggcttgaccggggatatgtcagcaggattgtgaagcagtttgaaaaagaagatttg
atttataaacagaggagcaaagatgacgcccgccaccattacatttttgtcacagaaaca
ggaaaaacgatttataaaaagctggaggagaaagccaacgaacaagtagaactgatgctg
aaggtaatcaaccaaaaggagcagcacaagcttgccgaggcgatggcagagattgaagcg
atcctttcacagtcgctttctgccagagcatcagagatatcgattagagattattttctt
tcggaggatcttcaactccttattgagaaacaaagacaattttacgcggaggctcacggt
tgggatgacacgtttttagcttatcttcaggagacatttgacgctgacatcgaaaaaata
tggattgcggaaagcggcgggaaatttgccggctctgtcgggttggtcaagcacgatgaa
aagacagtccagctcagatggtttctggttgatgcggattttcggggcagggggcttggc
acgcaattgctggagcatctggttgcatactgccaagacatgaagtttgaccgcattttc
ctttggacggtgagcacgatggctgaggctcgtccgctctataaaaaatttggattcagg
ataagtgaagtaaaacaagaagcgccattatggggacagcagctgacagaagaacggtgg
gatttggagctgtcatga

DBGET integrated database retrieval system