KEGG   Bacillus subtilis subsp. subtilis 168: BSU02170Help
Entry
BSU02170          CDS       T00010                                 

Gene name
ybfB
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 938436
NCBI-ProteinID: NP_388099
Pasteur: BG12733
BSORF: BG12733
UniProt: O31444
Position
236879..238129
Genome map
AA seq 416 aa AA seqDB search
MKRLHYAWIIVSVTFLILLAVQGVRLSFGAFVEPWERQFSIDRSTISLISTVSFIVYGIS
QPVIGRLVDKWGARAVLAWSALLTGVSIFLTYLVTSPWQLFLLYGLGVSLGVGGASNVAA
SVLVVNWFSKKRGLAFGIMEAGFGAGQMLLVPGSLMLIHWFSWKLTVVVLGLLLIVIVFP
AALLMLRNNPSEKNTEPIGGLAASEKETAPKTTALSVAGMFRMRQFWFLIFPFLICGFTT
VGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSGIVADRWSSRKILCILYAVR
ALSIVILIYSHEPYLLLAFAILFGLVDFATVAPTQMLATQYFQNYSIGLMIGWLSLAHQI
GSALGAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVMLREPAAVTRDSAAVVDK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactgcattatgcgtggatcatcgtctccgtcacctttttgatcttattggcg
gttcagggggtgcggctgtcgtttggtgcgtttgtggagccgtgggaacggcagttttca
atcgatagaagcaccatctcgctgatttcgacggtgagttttattgtttatggcatatca
cagcctgtgatcggtcggcttgtggacaaatggggtgcccgggctgttttggcatggagt
gcgttactgacaggagtcagcattttcttaacataccttgtgacttcgccttggcagctg
tttttgctttacgggctgggtgtctcgcttggagtgggcggagcatcgaatgtggcggca
agtgtattggtcgtcaattggttcagcaaaaagcggggactagcctttgggatcatggaa
gcaggctttggcgcggggcaaatgcttctcgttcccggctcactcatgttgatccattgg
tttagctggaagctgacggttgtggtgttgggactgctgttaatcgtgattgtctttccg
gctgcgctgctgatgctgcggaacaatccttcagaaaagaatacagagccgataggcgga
ctggctgcatcagaaaaagaaacagcacccaaaacaacagctctttcagtggccgggatg
tttcgtatgaggcaattctggttcttgatttttccgtttttgatctgtggatttacgacc
gtggggctgatggatacccatttgattccgttttctcatgatcatggcttttcaacgaca
gtcacgagtgctgctgtcagtctgctagcaggctttaatattgctgggatcttgctgtcc
ggaattgtagcggaccggtggagcagccggaaaatcctgtgcattttatatgcggtgcgg
gcgctgtcgatcgtgattcttatttacagccacgagccctacttgcttttagcctttgcg
attctgtttggattagtggactttgcaacggtagcaccgactcaaatgctcgccacccag
tactttcaaaactactcgatcggcctcatgattggctggctgtcactcgcccatcagatc
ggatcggcactaggtgcgtatgtgcccggcgtcatctacacggtaacgggtgagtataca
ctggctttttatttgtcgattggaatgctcgtgcttgcgagcgtaatgaatgtgatgctg
agggagccagctgcggttacgcgtgacagtgcggctgtggtagacaagtga

DBGET integrated database retrieval system