KEGG   Bacillus subtilis subsp. subtilis 168: BSU02180
Entry
BSU02180          CDS       T00010                                 

Symbol
ybfE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3611
Other DBs
NCBI-GeneID: 938443
NCBI-ProteinID: NP_388100
Pasteur: BG12734
BSORF: BG12734
UniProt: O31445
Position
complement(238164..238448)
AA seq 94 aa
MNHCLHSNTLAKIVCTVTLITLYFYFFSTRFNELIELAVQMFFALIGLFWVFIVSPFSRK
VQISERFKQKSENARIVGMIDFVLEQKYKKSISE
NT seq 285 nt   +upstreamnt  +downstreamnt
gtgaaccattgcttacattcaaacacacttgccaaaatcgtatgtactgtgacattaata
acgttatacttctattttttcagcactcgttttaatgaattaatagaattagctgtacaa
atgttttttgccttgatcggccttttttgggtttttattgtttccccattttcaagaaaa
gttcaaatttctgaacgcttcaaacaaaaatccgaaaacgcccgcatagtcggtatgatc
gacttcgtattagaacaaaaatacaaaaaaagcatctctgaataa

DBGET integrated database retrieval system