KEGG   Bacillus subtilis subsp. subtilis 168: BSU02190
Entry
BSU02190          CDS       T00010                                 

Symbol
ybfF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gly_acyl_tr_C
Other DBs
NCBI-GeneID: 938441
NCBI-ProteinID: NP_388101
Pasteur: BG12735
BSORF: BG12735
UniProt: O31446 A0A6M4JEG3
Position
complement(238644..239555)
AA seq 303 aa
MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHYYSEPSLPLQFLVKVA
VLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIFMTYTKIIKKGNKNKGK
ASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNEDSMNFSAVLNHVLTISKN
DKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSIIVVYATSLFSGQINYIDI
PHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRAEYLRMRGVIDFILTERYNK
KIM
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaatgatcaaatagtttttgaaaaaacaaaaaacatcgctcatgatatcaatcag
atgcaaaatcagcaggagataatagattatctttttcgccaagattctctgacactcaac
cagttgaagcactattattcggaaccttctcttccgcttcagtttcttgtgaaagtagca
gttttatgcatgtttatatctatgactttagcttctttccttttcatccaagcaaaagaa
gtcttcaccaatactattctttcagatatttcacctgcagtgttttctatttttacagtc
atttgtatttttatgacttatactaaaatcataaaaaaaggaaataaaaacaaaggaaaa
gcatcccttaatcaacgatctgaattctatgagaaaaacaagttaattaatacaatactt
tataaaaaatataaaatggatcaacaaaacatacaggctaataaacatactgcctctgat
aatgaagattcaatgaattttagtgctgtattgaatcatgttcttacaattagtaaaaat
gataaagagcttttgggctacttagatacaagagataatgctatgctaagccaattaaaa
gcatatttttcaactcgtccattttcccttccacattatatgagtttgatgttttgcgga
agtattattgttgtctatgcaacttctttattttcaggacaaatcaattacattgacata
ccacacatttttatctttctattattaattattttcttgaaaatccttattgatttgata
aagcttttaaatatatctagaaaaggacaattacatactgttctgcactttgcacagaga
gccgaatatttgcgaatgagaggagttatagattttattctaactgaaagatataacaaa
aaaatcatgtaa

DBGET integrated database retrieval system