KEGG   Bacillus subtilis subsp. subtilis 168: BSU02210
Entry
BSU02210          CDS       T00010                                 

Symbol
ybfH
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA TPT
Other DBs
NCBI-GeneID: 938440
NCBI-ProteinID: NP_388103
Pasteur: BG12737
BSORF: BG12737
UniProt: O31448 A0A6M4JEZ0
Position
complement(241917..242837)
AA seq 306 aa
MNIQRETSGHIAAIVTILIWGTTFISTKVLLADFSPMEILFYRFLMGFIALILVRPNMIP
FRNWRQELLFAGAGLFGVTLYFLLENIALTYTYASNVGMIVSIIPMITAVLAHFLLEGEK
LRLTFLIGFISALIGLLLITFNGNVVLRLNPLGDIMAAGAALVFGGYSIFMKKLSAYEYH
IIELTQRVFLYGLLFMVPALFLFDFHFDLSRFSSASNILNMLFLGIGASALCFATWNYSV
GVLGAVKSSAYIYMVPVITIAASVLILHENMTWIALLGGALTLLGLYISELKPKAKLLEN
GCKMDA
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaacatacaaagagaaacttcggggcatatcgcagccattgtgaccattctgatttgg
gggacgacctttatttcgacaaaagttctgctggctgacttctctccaatggaaatatta
ttttatcggtttttgatgggctttatcgctcttatcctcgtccgtcccaacatgattccg
ttcagaaattggcggcaggagctgttgtttgccggagctggtttatttggcgtaacctta
tactttctattagaaaatatagctctcacctatacatacgcctccaatgtcggcatgatc
gtgtccattataccgatgatcactgcggttttggcccattttctgctcgaaggcgaaaaa
ttgcgtctgacttttttgattggatttatctcggcactgatcgggcttttattgattacg
tttaacggcaatgtggtactgcgtctaaatccgctcggagacatcatggcagccggggct
gctctcgtgtttggcggatactcgatattcatgaaaaaattaagcgcctacgaataccac
atcatcgagctgacacagagagtatttttgtatggtttattgtttatggttcccgcttta
tttttgttcgacttccattttgacctaagccgattttcatctgcttcaaatatactcaac
atgcttttcttagggattggcgcttctgccctgtgcttcgccacttggaattattcagtt
ggagtgctcggagccgtcaaatccagtgcgtatatttacatggtcccggttatcacgatc
gccgcttctgtcctgattctgcacgaaaacatgacatggatcgctcttctaggaggcgcg
cttacacttttaggcctctacatttcagagctgaaaccgaaagcgaagctgttggagaac
ggatgtaaaatggatgcttaa

DBGET integrated database retrieval system