KEGG   Bacillus subtilis subsp. subtilis 168: BSU02220
Entry
BSU02220          CDS       T00010                                 

Symbol
ybfI
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AraC_binding HTH_18 HTH_AraC Cupin_2 AraC_binding_2
Other DBs
NCBI-GeneID: 938437
NCBI-ProteinID: NP_388104
Pasteur: BG12738
BSORF: BG12738
UniProt: O31449 A0A6M4JER0
Position
complement(242834..243661)
AA seq 275 aa
MQNETRTLQLDPHLHIEAYRFKGIMQKFPNHFHDYYVIGFIEKGQRYLACQDQEYIINPG
DLLLFNPRDTHSCEQIDGRTLDYRCINVMPDIMEKAVKEITGSGHLPYFSQHVLFRHELT
ASLQELHILISEEKQALRKEELFLHLLEELIRHYSDVTFLSSVPEPSDEVKMVCEFLEEH
YAENVTLNDLSELTGWSKYHLLRSFTKQKGITPNSYMETIRINQAKKLLEQGVRPIDAAF
QTGFSDQSHMTKFFKRQVGLTPKQYMKIFEKELHR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcaaaacgaaacccgcacactgcagcttgacccacaccttcatatagaagcctaccgc
ttcaagggaattatgcagaagttcccgaaccactttcacgattattatgtgattggattt
attgaaaaagggcaacggtatctggcctgtcaggatcaagaatatatcatcaatccaggt
gatcttctcctctttaacccccgtgacacgcatagctgtgaacagattgacggccggacg
cttgattatcggtgtatcaatgtcatgccggatatcatggagaaggcggtgaaagagatt
actggctccgggcatctcccttatttctcccagcatgtgttattccgccatgagctgaca
gccagcctgcaggaattgcatattttgatatccgaggaaaaacaagctttgcgtaaggag
gagctgtttcttcatctattagaggagctgatccgccattattcagatgtcacgttcctt
agcagcgttccagaaccatcagacgaagtcaaaatggtttgtgaatttttagaagagcat
tatgccgaaaatgttacactcaatgatttgagtgaattaacaggctggagcaagtatcat
ttattgcgttcatttacaaaacaaaaaggcattacccctaatagctacatggaaacaatc
cggattaatcaagccaaaaaactccttgaacaaggggtaaggccgattgatgcggcattt
cagacaggattcagcgatcagagtcatatgacgaagttttttaaacggcaggtggggctg
acgccgaagcaatacatgaagatttttgaaaaggagcttcacagatga

DBGET integrated database retrieval system