KEGG   Bacillus subtilis subsp. subtilis 168: BSU02230
Entry
BSU02230          CDS       T00010                                 

Symbol
purT
Name
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:6.3.1.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU02230 (purT)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.21  phosphoribosylglycinamide formyltransferase 2
     BSU02230 (purT)
SSDB
Motif
Pfam: ATP-grasp CPSase_L_D2 Dala_Dala_lig_C RimK ATP-grasp_3 GARS_A RmlD_sub_bind ATPgrasp_ST 2-Hacid_dh_C Epimerase ATP-grasp_4 Oxidored_nitro Shikimate_DH DUF5818 GARS_C
Other DBs
NCBI-GeneID: 938438
NCBI-ProteinID: NP_388105
Pasteur: BG10924
BSORF: BG10924
UniProt: P39771 A0A6M4JFH4
Position
243892..245046
AA seq 384 aa
MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVAHNSYVVDMLDPEQIR
TIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTMDREGIRRLAAETLGLA
TAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSEADLESCWETAMEGGRVK
NGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDYIESWQPHDMTEQQIEEAK
HIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGLVTLVTQNLSEFALHVRAIL
GFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPKTQVRVFGKPITKAGRRMAVA
LSAADSVETARENAKKALDQLILK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtatcaatcaaagaaggttttattgttaggttcaggtgaattaggtaaagaggtagtg
attgaagcccagcgtcttggggtacagacggtggcagttgacagttacgagcatgctccg
gcgatgcaggtcgcgcataacagttatgtcgttgatatgctggacccagagcagatcaga
accatcattgagaaagaaaatccggatttgattgtgcctgaggttgaggcgattgcgacg
gatgaattgctgaagcttgaagaggaaggatttcacgttatcccgaatgcccgtgcggcc
aagctgacgatggatcgggaaggcatcagacgacttgcggcggaaacgcttggacttgcg
acagctggctatgaatttgcgaatacatatgatgaatttatacaagcggcagctcagatc
ggttttccttgtgtcgttaaaccattgatgagttcttctggaaaaggccaaagtgtgtgc
cgctctgaagcggatttagagagctgctgggagacggcgatggaaggcggacgggtgaaa
aacggccgcgtgatcgttgaggagtttatccctttcgaatcagaaatcacactcttaacc
gtacgtgcggttaacggtacggcattttgtgagccgatcggtcatgtgcaaaaggacggg
gattatatcgaatcgtggcagccgcatgatatgacagagcagcaaatagaagaagcgaag
catattgcgaaaacgatcacggatgagcttggcggatacggcctgtttggtgttgagctg
ttccttgcgaaagatagggtatatttcagtgaggtatctcctcgtccgcatgatacgggt
cttgtcacgctggtgacgcaaaatttgtcagaatttgcgctgcatgtccgggcgattctc
ggctttccgattacagaaatcacacagctttctcctggcgccagcaggcccctcaaagcg
ccggaagaattagcggattacactgttgaaggattggaaaacgcactggcagtcccaaag
actcaagtgcgcgtctttggaaagccgataacaaaagccggacgtcgtatggcagttgcg
ctttctgctgctgattcagttgaaacggcaagagagaatgcaaagaaagcgttggaccag
ctaattttaaaatag

DBGET integrated database retrieval system