KEGG   Bacillus subtilis subsp. subtilis 168: BSU02230Help
Entry
BSU02230          CDS       T00010                                 

Gene name
purT
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU02230 (purT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU02230 (purT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     BSU02230 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp CPSase_L_D2 Dala_Dala_lig_C RimK ATP-grasp_3 GARS_A RmlD_sub_bind 2-Hacid_dh_C Oxidored_nitro Epimerase ATP-grasp_4 Shikimate_DH ATPgrasp_N GARS_C
Motif
Other DBs
NCBI-GeneID: 938438
NCBI-ProteinID: NP_388105
Pasteur: BG10924
BSORF: BG10924
UniProt: P39771
Position
243892..245046
Genome map
AA seq 384 aa AA seqDB search
MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVAHNSYVVDMLDPEQIR
TIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTMDREGIRRLAAETLGLA
TAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSEADLESCWETAMEGGRVK
NGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDYIESWQPHDMTEQQIEEAK
HIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGLVTLVTQNLSEFALHVRAIL
GFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPKTQVRVFGKPITKAGRRMAVA
LSAADSVETARENAKKALDQLILK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatcaaagaaggttttattgttaggttcaggtgaattaggtaaagaggtagtg
attgaagcccagcgtcttggggtacagacggtggcagttgacagttacgagcatgctccg
gcgatgcaggtcgcgcataacagttatgtcgttgatatgctggacccagagcagatcaga
accatcattgagaaagaaaatccggatttgattgtgcctgaggttgaggcgattgcgacg
gatgaattgctgaagcttgaagaggaaggatttcacgttatcccgaatgcccgtgcggcc
aagctgacgatggatcgggaaggcatcagacgacttgcggcggaaacgcttggacttgcg
acagctggctatgaatttgcgaatacatatgatgaatttatacaagcggcagctcagatc
ggttttccttgtgtcgttaaaccattgatgagttcttctggaaaaggccaaagtgtgtgc
cgctctgaagcggatttagagagctgctgggagacggcgatggaaggcggacgggtgaaa
aacggccgcgtgatcgttgaggagtttatccctttcgaatcagaaatcacactcttaacc
gtacgtgcggttaacggtacggcattttgtgagccgatcggtcatgtgcaaaaggacggg
gattatatcgaatcgtggcagccgcatgatatgacagagcagcaaatagaagaagcgaag
catattgcgaaaacgatcacggatgagcttggcggatacggcctgtttggtgttgagctg
ttccttgcgaaagatagggtatatttcagtgaggtatctcctcgtccgcatgatacgggt
cttgtcacgctggtgacgcaaaatttgtcagaatttgcgctgcatgtccgggcgattctc
ggctttccgattacagaaatcacacagctttctcctggcgccagcaggcccctcaaagcg
ccggaagaattagcggattacactgttgaaggattggaaaacgcactggcagtcccaaag
actcaagtgcgcgtctttggaaagccgataacaaaagccggacgtcgtatggcagttgcg
ctttctgctgctgattcagttgaaacggcaagagagaatgcaaagaaagcgttggaccag
ctaattttaaaatag

DBGET integrated database retrieval system