KEGG   Bacillus subtilis subsp. subtilis 168: BSU02240
Entry
BSU02240          CDS       T00010                                 

Symbol
mpr
Name
(RefSeq) extracellular metalloprotease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Trypsin Trypsin_2 Lamp
Other DBs
NCBI-GeneID: 938430
NCBI-ProteinID: NP_388106
Pasteur: BG10690
BSORF: BG10690
UniProt: P39790 A0A6M3Z6Z9
Position
245190..246131
AA seq 313 aa
MKLVPRFRKQWFAYLTVLCLALAAAVSFGVPAKAAENPQTSVSNTGKEADATKNQTSKAD
QVSAPYEGTGKTSKSLYGGQTELEKNIQTLQPSSIIGTDERTRISSTTSFPYRATVQLSI
KYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASTITAAPGRNGSSYPYGTYSGTMF
YSVKGWTESKDTNYDYGAIKLNGSPGNTVGWYGYRTTNSSSPVGLSSSVTGFPCDKTFGT
MWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQTAIAIHTNGGSSYNLGTRVT
NDVFNNIQYWANQ
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaattagttccaagattcagaaaacaatggttcgcttacttaacggttttgtgtttg
gctttggcagcagcggtttcttttggcgtaccggcaaaagcggcagagaacccgcaaact
tctgtatcgaataccggtaaagaagctgatgctacgaaaaaccaaacgtcaaaagcagat
caggtttccgccccttatgagggaaccggaaaaacaagtaaatcgttatacggcggccaa
acggaactggaaaaaaacattcaaaccttacagccttcgagcattatcggaactgatgaa
cgcaccagaatctccagcacgacatcttttccatatagagcaaccgttcaactgtcaatc
aagtatcccaacacttcaagcacttatggatgtaccggatttttagtcaatccaaataca
gtcgtcacggctggacattgtgtgtacagccaggatcatggatgggcttcgacgataacc
gccgcgccgggccgcaatggttcgtcatatccgtacggtacttattcaggcacgatgttt
tactccgtcaaaggatggacggaaagcaaagacaccaactatgattacggagctattaaa
ttaaacggttctcctggaaacacggttggctggtacggctaccggactacaaacagcagc
agtcccgtgggcctttcctcgtcagtgacaggattcccatgtgacaaaacctttggcacg
atgtggtctgatacaaagccgattcgctccgctgaaacgtataagctgacctatacaacc
gatacgtacggctgccaaagcggctcgcctgtttatcgaaactacagtgatacagggcag
acagctattgccattcacacgaacggaggatcgtcatataacttgggaacaagggtgacg
aacgatgtattcaacaatattcaatattgggcaaatcaataa

DBGET integrated database retrieval system