KEGG   Bacillus subtilis subsp. subtilis 168: BSU02260
Entry
BSU02260          CDS       T00010                                 

Gene name
ybfK
Definition
(RefSeq) carboxylesterase YbfK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Ndr Esterase
Other DBs
NCBI-GeneID: 938434
NCBI-ProteinID: NP_388108
Pasteur: BG12740
BSORF: BG12740
UniProt: O31452 A0A6M3Z746
Structure
PDB: 
4CCY

Position
246658..247548
AA seq 296 aa
MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTHIIASGPKDAPSLILL
HGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAAMETRADFAEWMKDVFDSLGL
ETAHLAGLSLGGSHIVNFLLRAPERVERAVVISPAEAFISFHPDVYKYAAELTGARGAES
YIKWITGDSYDLHPLLQRQIVAGVEWQDEQRSLKPTENGFPYVFTDQELKSIQVPVLLMF
GEHEAMYHQQMAFERASVLVPGIQAEIVKNAGHLLSLEQPEYVNQRVLSFLCGGIK
NT seq 891 nt   +upstreamnt  +downstreamnt
atgatacaagattcaatgcagtttgccgcggttgaaagtggtctgcgcttttaccaggca
tatgatcaaagcctttctttgtggccgattgagtcggaagcattctatgtttctactcgt
tttggaaaaacacatatcattgcaagtgggccaaaggacgcaccttcgctcattttgctt
cacggaggccttttcagctctgcgatgtggtatccgaatatcgcagcgtggagcagtcaa
tttcgtacatatgcggtcgatataataggagacaaaaataaaagtataccatcagcagcc
atggaaacgagagctgattttgcagaatggatgaaagatgtctttgattctcttggactt
gagacggcacatctggccggcctttcgcttggcgggtcccatatcgtgaatttcttactc
cgcgcgcctgaaagagtagagcgggcggttgttatcagtcccgctgaagcgtttatttca
tttcatccggatgtctataaatacgctgcagagcttacaggggcaagaggagctgaatca
tatatcaagtggatcacaggcgacagttatgatctgcatcctttactgcaaagacaaatt
gtggcgggcgtggaatggcaggatgagcaaaggagcctgaagccgacagaaaacggcttt
ccgtacgtgttcacagaccaggaattgaaatcaatacaagtcccggtacttctgatgttc
ggtgagcacgaggctatgtaccatcagcaaatggcctttgagcgggcttcggtattggtg
ccgggaattcaggctgaaatcgtaaagaacgccggacatctgttatctctggagcagcca
gagtacgtcaatcaacgcgtcttgtcctttttatgcggggggataaaatag

DBGET integrated database retrieval system