KEGG   Bacillus subtilis subsp. subtilis 168: BSU02280
Entry
BSU02280          CDS       T00010                                 

Symbol
ybfM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNARE_assoc Sm_multidrug_ex Peptidase_A24 PEN-2
Other DBs
NCBI-GeneID: 938432
NCBI-ProteinID: NP_388110
Pasteur: BG12741
BSORF: BG12741
UniProt: O31453 A0A6M3Z6W1
Position
248268..248756
AA seq 162 aa
MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTDVLNYELSILISFVGA
LLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYGPYSLILGYFIPGVRHV
TCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV
NT seq 489 nt   +upstreamnt  +downstreamnt
atggaattagttcagcagctcatagcggattacggttatctcgctatttttttgatgctg
gtattaggaattgtaggattgccgattccagatgaagtgatgatgaccgttgttggctat
ttcacgcataccgatgtattgaattatgagctttcgatattgattagttttgtcggggct
ttgttaggtatgctgatcagctacatgattggcagaaaagccggacgcccgtttatcgac
aagtacggcaagtgggtcggcttaaaagaaaaaagaatgatgaaagtggaaaaatggatg
aagaaatacggtccatattctcttattttaggttattttattcccggcgtcagacatgtg
acgtgctacttttcggggatcggcaaaatggatctgaaaacgtatgttgcgtttgctgca
atcggcgcctttttatggtgctttgtttttattacaatcggaagggttatagggattatt
catgtttaa

DBGET integrated database retrieval system