KEGG   Bacillus subtilis subsp. subtilis 168: BSU02290
Entry
BSU02290          CDS       T00010                                 

Symbol
psd
Name
(RefSeq) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU02290 (psd)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BSU02290 (psd)
SSDB
Motif
Pfam: PS_Dcarbxylase
Other DBs
NCBI-GeneID: 938431
NCBI-ProteinID: NP_388111
Pasteur: BG11013
BSORF: BG11013
UniProt: P39822 A0A6M4JEH3
Position
248749..249540
AA seq 263 aa
MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKHFRLNWDDVDGTAADY
GSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGIINPNQTFTVKGKDYSFAELTGC
KSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRSYPVNQLGLKYGKDVLSK
NYRFVYELNSGSRNVLMIPVGAMNINSIVQTNTRTELEIGEELGYFSFGSTVILVFEKDA
FQPSAHLAEGQEVQVGELIGYEE
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttaatacggctgtaaagattctgtatcgatcattgatagagctgacgaatcatcgt
ctgtcatcctatctgattaaaggattttgcgagtcgaaaatcagcaaaccggtcattccg
cttttctcaaaacattttcggctgaattgggatgatgtggacggtacggctgctgattac
ggatcgctgtccgaattgttcattcgacaaataaatctggagcggcgccctgtgtcaaaa
gaggcgcatgcggtggtcagccctgttgacggtgtggttcagacggtaggaatcatcaac
ccgaatcaaacctttacggtgaagggaaaagattactcattcgctgagctgaccggctgt
aaaagcgcagaccatcaatacaacggcggatatttcgtcgtgctgtatttaagcccgagg
cattatcaccgtttccattctccgatcagctgcaggtatcaaaagctggccgagctcgga
aatcgctcatacccggtaaatcaactaggcttaaaatacgggaaagatgtgctgtcgaaa
aattatcggtttgtgtacgagctgaatagcggcagccgaaatgtcctgatgattcctgtc
ggcgcgatgaatattaattctatcgtgcagacgaatacccgtactgaattggagatcggc
gaggagctgggatacttttcatttggctcaaccgtcattttggtttttgaaaaagacgcg
ttccagccgtccgcccatttagcagaaggccaagaagtccaagtcggagaactgataggt
tacgaagaataa

DBGET integrated database retrieval system