KEGG   Bacillus subtilis subsp. subtilis 168: BSU02300
Entry
BSU02300          CDS       T00010                                 

Gene name
ybfN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938429
NCBI-ProteinID: NP_388112
Pasteur: BG12742
BSORF: BG12742
UniProt: O31454 A0A6M4JF15
Position
249595..249873
AA seq 92 aa
MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQANNLREKGIERFPFI
ISKYQADVQLPVETFLQNTYRFYFHQVMRESS
NT seq 279 nt   +upstreamnt  +downstreamnt
atggagaaacaaatcatcagctggattacagattatcagaacaccggagatgaagccgtc
ctgcggcaagtgcgagaagtgtgctggccgatcgttgaagcggttttgcaagagaaagta
atggatgatgaacaagcgaacaatttgcgcgaaaaaggaatcgagcggtttccattcatc
atcagcaaataccaagcggatgtgcagcttccggttgagacatttttacaaaatacgtat
cggttttactttcatcaggtgatgagagaatccagctaa

DBGET integrated database retrieval system