KEGG   Bacillus subtilis subsp. subtilis 168: BSU02310
Entry
BSU02310          CDS       T00010                                 

Gene name
ybfO
Definition
(RefSeq) hydrolase YbfO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Erythro_esteras DUF489
Other DBs
NCBI-GeneID: 938424
NCBI-ProteinID: NP_388113
Pasteur: BG12743
BSORF: BG12743
UniProt: O31455 A0A6M4JF01
Position
249979..251319
AA seq 446 aa
MKRMIVRMTLPLLIVCLAFSSFSASARAASEEKYWDHWIERHAQPLDASNASNKDLRFLK
KVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFESGFPDTNASYLNMDQL
TPKSTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDIQSMKNSFNVAATQWVKA
VDPEKAELLSQSENDFSTLVTDSNTFDEFSQKKEKLVKNYQKLIKFTKTHASELKENLPK
EPKAYEMFMHSLQLRIDVMETYMLEEMKEKLEEYPENIEDFSFFMRDRMMAEQFQWVADT
LYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLPERLKKQTYTIGIYAYSGASL
DSSDNKTVKPVTSPPPSGSLEALLKAADRPAVFVDFLHTKNKKGTSWMYTPRTALYWGYM
EEQMILKEQYDGVIWLEHITPSVIIK
NT seq 1341 nt   +upstreamnt  +downstreamnt
ttgaaacgaatgatagtgagaatgaccctgccgctgctgatcgtttgtctggcgttttct
tctttttcagcctcagcccgtgctgcttctgaagaaaaatattgggatcactggattgaa
cgacatgcacagcctctggatgcttccaatgcttcaaacaaagaccttcgatttctaaaa
aaggtgctgaagggaaaacgaatcgttcagttaggagaaaccacacacggtgctggcgaa
atcaatgccacaaaggtcagaatgatcaaatacctccacgaagagctgggatacgatgta
ttggcctttgaatccggctttcctgatacaaatgcatcctaccttaatatggaccaatta
acccctaaaagcacgatgaaaaactccatttacgctgtatggcacacagaagatgtcgtc
gaattgtttgattacatgaaagagcaaaaagagaaaggcgatccgctgatccttaccggt
tttgatattcaaagcatgaagaattcattcaatgtagctgcgactcaatgggtaaaagcg
gtggaccctgagaaagcagagttgctctcccaatcagaaaatgatttttcaacattagtg
acagacagcaatacgtttgatgaattttcgcaaaagaaggaaaagcttgtgaaaaactat
cagaagctgatcaagttcactaaaacacatgcttcagagctaaaagaaaaccttccaaaa
gagccgaaagcttatgagatgtttatgcattctcttcagctgagaattgacgtaatggaa
acatatatgctggaagaaatgaaagaaaaactagaggagtatccggagaatattgaggat
ttttcattctttatgagagaccgcatgatggctgaacaatttcagtgggtagccgacacc
ctttatccgaaaaagaaaatcattgtctggggccacaattaccatctacgcaaacagaat
acgaagatgataaaggactgggtacagctaaacggccctaacatgggtgattatttgccg
gagcggctgaaaaaacaaacatatacgattggcatttatgcttactcaggtgcgagtctt
gatagctccgataataagactgttaagccggttacaagcccgccgccgtctgggagcctt
gaagctttgctgaaagcggcggaccgaccggctgtttttgttgattttctccatacaaaa
aacaagaaaggcacttcgtggatgtataccccgcggactgcgctctattgggggtacatg
gaagagcagatgatcctgaaggaacaatatgacggtgtcatttggctggagcatatcacg
ccctctgtcattatcaagtga

DBGET integrated database retrieval system