KEGG   Bacillus subtilis subsp. subtilis 168: BSU02330
Entry
BSU02330          CDS       T00010                                 

Gene name
ybfQ
Definition
(RefSeq) hypothetical protein
  KO
K07146  UPF0176 protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU02330 (ybfQ)
SSDB
Motif
Pfam: UPF0176_N Rhodanese_C Rhodanese
Other DBs
NCBI-GeneID: 938426
NCBI-ProteinID: NP_388115
Pasteur: BG12745
BSORF: BG12745
UniProt: O31457 A0A6M3Z7G6
Position
252514..253482
AA seq 322 aa
MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEGINGTVSGTVEQTEKY
METMKADPRFADMVFKIDEAEGHAFKKIFVRHKKELVTLRLEDDVDPNETTGQHLKPAEF
YEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWIEEHKDMLEGKKILTYCT
GGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWDGQCYVFDERISVPVNRVE
HVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMRSCSHECRTNPRNLYVKEHN
MTEEEVNARLAAIETEDHAAAE
NT seq 969 nt   +upstreamnt  +downstreamnt
atggaaaaacaatacagagtattactttactataaatatgttccgattgaagatccagag
gcgtttagagagcagcatctggctttttgtaaggagcttggtttgttaggccgtatcctt
gtttcttctgaaggaattaacggtacggtatcaggtacggttgaacagactgaaaaatat
atggaaacaatgaaagctgatcctcgctttgcggacatggtatttaaaattgatgaagca
gaaggccatgccttcaaaaaaatcttcgtccgccataaaaaagagcttgtaacgcttcgt
cttgaagatgatgtcgatccgaacgaaacaacaggccagcatttgaagcctgcagaattt
tatgagaagatgcaggatccaaacacaattgtcatcgacgcgcgtaacgattacgagtat
gaccttggccatttcagaggtgcggtccgtcctgacatcgaagccttccgtgaattacct
gaatggattgaagagcacaaagatatgcttgaaggcaaaaagattttaacgtactgtaca
ggcggcgtgcgctgtgaaaagttctcaggatggctggtgaagcaaggctttgaagatgta
gctcagcttgatggcggaatcgtgacatacggaaaagatccagaggtgcaaggcaagctt
tgggacggccagtgctacgtatttgatgaaagaatcagcgtgcctgtcaaccgtgtcgag
catgtgattgtcggcaaggactactttacaggagaaccgtgtgagcgttatgtgaactgc
gcaaatccatcttgcaataaaaaaatgatatgcacaccggaaaatgagtataaatatatg
cgcagctgcagccacgaatgccgcacgaacccaagaaacctgtatgtgaaagagcataat
atgacagaagaagaagtaaacgcaagactggcagcgattgaaacagaagatcacgctgct
gctgaataa

DBGET integrated database retrieval system