KEGG   Bacillus subtilis subsp. subtilis 168: BSU02340
Entry
BSU02340          CDS       T00010                                 

Symbol
gltP
Name
(RefSeq) proton glutamate symport protein
  KO
K11102  proton glutamate symport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02340 (gltP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU02340 (gltP)
SSDB
Motif
Pfam: SDF IncF
Other DBs
NCBI-GeneID: 938421
NCBI-ProteinID: NP_388116
Pasteur: BG11015
BSORF: BG11015
UniProt: P39817 A0A6M4JCS5
Position
complement(253518..254762)
AA seq 414 aa
MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIVVPIVFSTIVIGAAGS
GSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLSHLAKKDIHELSGYTDK
VVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIGKASEPVMKFFESTAQIM
FKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVFLGLFLILFVLFPLVGLIF
QIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCPKRVVSFVVPSGLSLNCDGS
SLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAAVPSGSLVVLLATANAVGLPA
EGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAFRQKEWVSANSQTESI
NT seq 1245 nt   +upstreamnt  +downstreamnt
ttgaaaaaattaatcgcgtttcaaattttaatcgctttggctgtcggcgcggtgatcggc
cacttttttcctgatttcgggatggcactgaggcctgtcggagatggatttatccgcctg
attaaaatgattgttgtgccgattgtattttctaccattgtcattggagccgcaggaagc
ggaagcatgaaaaaaatgggcagtctcggcatcaagacgatcatttggttcgaagtgatt
acaacgttggtattagggcttggacttttattagcgaatgtcttaaaaccaggtgtcggg
cttgacctctcccatttggcaaaaaaagatattcatgaactttccggctacacagacaaa
gttgttgatttcaagcaaatgatcctggatattatccctacaaacattattgatgtcatg
gccagaaatgatttgcttgccgttattttcttcgccattttatttggtgtcgccgcagct
ggtatcggcaaagcttctgaaccagtaatgaagttttttgaatctacagctcagattatg
ttcaagctcacgcaaatcgtcatggtcactgctcctatcggcgtgttagccctgatggct
gcttctgtaggccaatatggcattgaactcctcctccctatgtttaagctggttggcacc
gtattccttggcctgttcctgatcctctttgtcctctttccgcttgtcggtctcatcttt
cagattaagtatttcgaagtattgaaaatgatatgggatctgtttttaattgcattttcc
accacaagcactgaaaccattctccctcagctgatggatagaatggagaaatacggctgt
cccaaacgagtggtatcatttgtcgttccctccggcttgtcattgaactgtgacggctcc
agcttatatttatcggtttcttgtatctttctcgcacaggcctttcaagtagacatgaca
ttgtcccagcagctgctcatgatgcttgtgcttgtgatgaccagtaaaggcattgcagct
gtaccctcaggatcgcttgtagttcttctggcgactgccaatgctgtaggactgccggct
gaaggcgttgccattatcgcgggtgttgaccgcgtcatggacatggcgagaacaggcgtg
aacgtaccgggacatgcgatcgcctgtatcgtggtatcaaaatgggaaaaggccttccgc
caaaaagaatgggtttccgcaaacagccaaactgaaagcatatag

DBGET integrated database retrieval system