KEGG   Bacillus subtilis subsp. subtilis 168: BSU02350
Entry
BSU02350          CDS       T00010                                 

Symbol
nagP
Name
(RefSeq) PTS system-glucosamine-specific transporter subunit EIICBA
  KO
K02765  D-glucosamine PTS system EIICBA component [EC:2.7.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU02350 (nagP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU02350 (nagP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02350 (nagP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     BSU02350 (nagP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosamine-specific II component
    BSU02350 (nagP)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIA_1 PTS_EIIB Peptidase_M23 YwiC
Other DBs
NCBI-GeneID: 938418
NCBI-ProteinID: NP_388117
Pasteur: BG11014
BSORF: BG11014
UniProt: P39816 A0A6M3Z6Z8
Position
complement(254907..256802)
AA seq 631 aa
MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKDAGGVVFDNLPLIFAV
GVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGAEHLIDMGVFGGIIIGL
LAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFSFVWPLIQNGINAASSLI
ADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPSTGNTVTGDLTRFFAGDPTA
GRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISAALTSMLTGITEPVEFSFLF
VAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVLNYGLSTNGWVVIPVGIVFAF
IYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQLAFHVLQALGGQQNIANLDACI
TRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFGTKSDALKDDIKTIMAGGVPATA
AALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQVFSEKMMGEGFAIIPSEGKVVAPA
DGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLNGEGFEAHVTSGQAVKQGELLLTFD
LNYIKQHAASAITPVIFTNTSEEDLKHIQMK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgtttaaaaaggcatttcaaattctgcagcagcttggccgcgcgttgatgactccggtt
gccgtcctgccggcagcaggtcttttgctccgtttcggagacaaggatttactgaacatc
cctattataaaggatgcgggcggcgttgtattcgataaccttccgctgattttcgccgtg
ggggtcgcgatcggattagccggcggagaaggtgtagccggacttgccgctgtcatcgga
tacttaattttaaccgtcaccctcgacaatatgggaaaattactcggccttcagcctccg
tatgaaggagccgagcacctgattgatatgggggttttcggaggaatcattatcgggctt
ctcgccgcctatttatataagcgattttcatcaatcgagctgcatccggtccttggattt
ttctctggaaaacgctttgtcccgatcattacttccgtcagttcattggtgatcggcgtc
attttctcattcgtttggccgctgatccaaaacggaattaacgcagccagcagtttaatt
gccgattcaacagtcggcctgttcttttatgcaacgatctatcgtttgctgattcctttt
ggcctgcatcatattttttatacgcctttctattttatgatgggagaatacacagaccca
tcaacaggcaacaccgtaaccggcgacctgacaaggtttttcgcgggagacccgacagcc
gggcgctttatgatgggggatttcccttacatgattttctgtctgccggccgttgctctt
gccattatccataccgcgcgtccggaaaagaaaaaaatgatctccggcgtgatgatttct
gcggcgctcacatctatgctgaccggaattacagaaccggttgagttttctttcttgttc
gttgcgcccgtgctctatttgattaactctattcttgccggcgtcatctttgtcgtttgt
gatttattccatgtccgccacggctatacgttctcaggcggaggaattgactacgtcttg
aactacggactgtctacaaacggctgggttgtcattcctgtcgggatcgtgtttgctttc
atttattattatttgttccgatttgcgattctgaaatggaatttgaaaacgcccggccgt
gagacagatgaagacggtcagaatgaggagaaagctccagttgcaaaagaccagcttgcc
tttcacgtgctgcaggccttgggcggacagcaaaatatcgctaacctggatgcatgtatc
acaaggcttcgtgtgaccgttcatcagccaagccaagtctgcaaggatgaattaaaacgg
cttggtgcagtaggtgtgctggaggtcaacaacaacttccaggcaatattcggaaccaag
tccgatgccttaaaagacgacatcaaaacaatcatggccggaggcgtccctgccaccgcc
gccgcgctggacacggtaactgacaaaccgctgaagcccgattccgatgagacctttatt
tatccgattaaaggagaaacagtctctttaggggatgtgcctgatcaggtcttttcagaa
aaaatgatgggcgagggatttgcgattataccatcagaaggaaaagtcgttgcacctgcg
gacggcgagatcgtctcgatttttccgacaaaacacgccatcggctttatgagcgccggc
ggcactgaaatcctgattcatgtcggcatcgataccgtcaaactgaatggggaaggcttt
gaagcacatgtcacaagcggacaagccgtcaaacaaggcgaactgcttctcacctttgat
ctcaattacatcaagcagcatgccgcttcagccataacaccggttattttcacaaatacc
tctgaagaagatctaaagcacattcaaatgaagtaa

DBGET integrated database retrieval system