KEGG   Bacillus subtilis subsp. subtilis 168: BSU02380
Entry
BSU02380          CDS       T00010                                 

Gene name
ybgB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1648 TMEM173
Other DBs
NCBI-GeneID: 938423
NCBI-ProteinID: NP_388120
Pasteur: BG12748
BSORF: BG12748
UniProt: O31460 A0A6M3Z6W9
Position
258532..258807
AA seq 91 aa
MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLTVNKLAGTVMLPVLMV
VFAWARKINWQFVFAVYILLICHIVVLCLAL
NT seq 276 nt   +upstreamnt  +downstreamnt
atgtttttatttacgaatggaaaagtgctgtggggagcagtgattgctgcattcatcctt
tcaattgtattttacccttttctgccgacgcagatgccgattcattatgatgttgcgaac
agtccggatctgacggttaacaagctggcggggactgtgatgctgcctgttttgatggtg
gtgtttgcatgggcgcggaagatcaattggcaatttgtattcgcagtgtatattttgctg
atttgccacattgtcgtcctttgtttagcgctctaa

DBGET integrated database retrieval system