KEGG   Bacillus subtilis subsp. subtilis 168: BSU02400
Entry
BSU02400          CDS       T00010                                 

Gene name
ybgF
Definition
(RefSeq) amino acid permease YbgF
  KO
K16235  S-methylmethionine transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02400 (ybgF)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU02400 (ybgF)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 938415
NCBI-ProteinID: NP_388122
Pasteur: BG12750
BSORF: BG12750
UniProt: O31462 A0A6M4JF22
Position
complement(260123..261535)
AA seq 470 aa
MNSAHNKNETTFQRSMKSRHLFMLSLGGVIGTGLFLSSGYTIQQAGPAGTILAYLVGAGI
VYLVMLCLGELSVAMPVTGAFHTYAAKYIGPGTGFTVAWLYWLTWTVALGSEFTAAGLLM
QRWFPHTSVWMWSAVFALFIFLLNAFSVKFFAESEFWFSSIKVLAIVLFILLGGSAMFGI
IPIKGGEAAPMLSNFTAEGGLFPNGFVPILMTMLSVNFAFSGTELIGIAAGESVDPDKTI
PKAIKTTVWRLSLFFVGTIFVLSGLIPIQDAGVIKSPFVAVFDRVGVPYAADIMNFVILT
AILSAANSGLYASSRMLWSLSKEKTLHPTFAKLTSKGTPFNALVFSMIGGILSLLSSVFA
PDTVYVVLVSISGFAVVVVWMGIAASQFMFRKRYIEAGNKVTDLKYRTPLYPFVPIAAFL
LCLASVVGIAFDPNQRIALYCGVPFMAICYAIYYVKNRKSQPAADMTHSK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaactctgcccacaacaagaatgagacaacctttcagagaagtatgaaaagccggcac
ctctttatgctttccttgggaggtgtcatcggaaccgggctgtttttaagctcaggttat
accattcagcaagcaggcccggccggaacgatactcgcctacttagtcggggccggcatc
gtctatctggtcatgctatgcctcggtgagctgtcagtcgccatgcctgtgaccggcgcc
tttcacacctatgcagccaaatacatagggccgggcaccggatttacggtcgcttggctg
tattggctgacatggaccgtggcattgggatcagaattcacagcagccggcctgttaatg
cagcgctggttcccccatacatcggtttggatgtggagtgccgtctttgcgctgttcatc
ttcttgcttaacgcattttcggtcaagtttttcgctgaatcagaattttggttttccagc
atcaaagtattagccattgtattatttattcttttaggcggctctgccatgttcggcatc
atcccgatcaaaggcggagaagccgctccgatgctgtccaacttcacggcggaaggcggg
ctttttcccaatggatttgtcccgattttgatgacgatgctgtccgtcaattttgccttt
tcgggaacggaactaatcggaatcgcagccggtgaaagcgttgatcctgacaagacgata
ccaaaagcgataaaaacaacggtctggcgtctctcgctcttctttgtcggaacaattttt
gtgctgtcagggctgattccgattcaagatgcaggtgtcatcaaaagcccgtttgtcgct
gtctttgacagagtcggtgtaccatacgcagccgatatcatgaactttgttatcctgaca
gcgatcctgtcagcggctaattccggactctacgcttcttcccggatgctgtggtcttta
tcaaaagaaaaaacgcttcatccgacatttgcaaagctgacgtcaaaaggaacccctttt
aacgcgctggtgttcagcatgatcggcggcattctgtcgttgctgtccagcgtatttgcg
ccagacactgtatacgttgtgctcgtgtcgatttccggttttgccgtcgttgtcgtgtgg
atgggaatcgctgcttctcaattcatgttcagaaaacgttatatcgaagcgggaaacaag
gttactgatttgaaatacagaacccctttgtatccgttcgtgccgattgctgcgttcctg
ttatgcctggcttccgtcgttggcattgcctttgatccgaatcaaagaatcgcactctat
tgcggcgttccatttatggccatttgctatgcaatatattatgtaaaaaaccgcaaaagc
cagccggctgctgatatgactcattcaaaataa

DBGET integrated database retrieval system