KEGG   Bacillus subtilis subsp. subtilis 168: BSU02410
Entry
BSU02410          CDS       T00010                                 

Symbol
mmuM
Name
(RefSeq) homocysteine S-methyltransferase YbgG
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU02410 (mmuM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BSU02410 (mmuM)
SSDB
Motif
Pfam: S-methyl_trans Kelch_1
Other DBs
NCBI-GeneID: 938412
NCBI-ProteinID: NP_388123
Pasteur: BG12751
BSORF: BG12751
UniProt: O31463 A0A6M3Z794
Position
complement(261656..262603)
AA seq 315 aa
MNPIQHILDTYPLIVLDGAMATELERKGCNLNDSLWSAKILMEEPELIKQVHTDYFAAGA
DCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFWSLEENRLNRPKPIIAA
SIGPYGAYLADGSEYRGNYAISEDELIEFHRPRMKALIEAGADVLACETIPCLTEAKAIV
RLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHRQIAALGINCTPLQHIPSLIE
ELKKNTSKPIIVYPNSGEQYDPETKTWNGAACAESYGASARTWHEKGARLIGGCCRTKPE
NIQEIAAWARSLKTT
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaatcctatccaacacatattagatacatacccgcttattgtgctagacggcgccatg
gcgaccgagcttgaacgcaagggctgtaatttgaatgacagtctgtggtcggcaaaaatc
ctgatggaagagccggagctgattaaacaagttcatactgattattttgcggcaggcgcc
gattgtgcaatcaccgccagctatcagtctacatttgaaggctttgccgcacgcgggctg
agcgaagcggaagcacgccggctcatcgagttgtccgtcagcatcgcagctgaagcacgt
gatgaattttggtcgcttgaagagaaccgtttgaatcggccaaaaccgatcattgcggct
tctataggcccttatggcgcttatcttgcagacgggtctgagtatcgcggcaactacgca
atatcagaagatgaactgattgaatttcatcgcccccggatgaaggcgctgattgaagcc
ggagctgatgtattggcatgcgaaacgattccgtgtctgactgaagccaaagcgattgtt
cggctgttgaaggaatttcctgaaacgtatgcatggatcagcttcagtgctaaagacggc
ttgcatatcagtgacggaacacctgcagctgactgcgcatcgtggcttgatgaacaccgc
caaattgcagcactcggcatcaactgcacgccgcttcagcatatcccttccttgatagag
gagttaaaaaagaacacgtcaaaaccgatcattgtctacccgaattcaggtgagcaatat
gatccggaaacaaaaacgtggaacggcgcagcatgcgcagaatcttacggggcgagcgcc
cgcacctggcatgaaaaaggagcgaggctgattggcggctgctgccggacaaaacccgaa
aatattcaagaaattgcggcttgggcccgctctttaaaaacaacttga

DBGET integrated database retrieval system