KEGG   Bacillus subtilis subsp. subtilis 168: BSU02420
Entry
BSU02420          CDS       T00010                                 

Gene name
glnT
Definition
(RefSeq) sodium/glutamine symporter GlnT
  KO
K11626  putative sodium/glutamine symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02420 (glnT)
SSDB
Motif
Pfam: Na_Ala_symp
Other DBs
NCBI-GeneID: 938419
NCBI-ProteinID: NP_388124
Pasteur: BG12752
BSORF: BG12752
UniProt: O31464 A0A6M4JFL2
Position
complement(262732..264168)
AA seq 478 aa
MQQILEHIVGIANDLLWSKLLIVLLLSFGIYFTFRLKFLQVRMLKEMVRVLREGAASRSK
NSISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIAIIGSASSFVESTLAQI
YKVKDVNGFRGGPAYYMEKGLNKRWMGALFAVLITLSFGIVFNSVQSNTVSLAFENAFGT
NRLTLGLILIAVFGTIIFGGVKRIAKLAESIVVVLAVLYIGVAFFVIFSNITQLPGVLAL
IVKNAFGFDQAAGGALGAALMQGVRRGIFSNEAGMGSAPNAAATATTSHPVKQGLIQAFG
VLTDTLVICTSTAFIILFSDAYHTPGLSGIALTQASLSSHVGSWASGFLAILILLFGFCA
LIGNYYYGETNIGFLNKSKKLIFVYRIGVLAMIVFGCVAKVQLVWDLADLFMGLMVIVNL
IAIFLLSKVVFTALKDYTRQKKAGKDPVFYKDVLKNHNGIECWPVSDTKTDTHNKQIS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcagcaaatcctagaacatatcgtcggtattgcaaatgatcttttgtggtcaaagcta
ttaattgttttgctcctttcttttggaatctattttacgttcaggcttaagtttttacag
gttcgcatgctgaaagaaatggtcagggtattaagagaaggtgctgcttcccggtcaaaa
aacagcatttctccgtttcaagccttttgcatcagcatggcggcccgtgtcggaacggga
aatattacgggcattgctatcgccattgcactcggcgggcccggtgcaatcttctggatg
tggattatcgccattatcggatcagcatccagctttgtggaaagcacactggctcagatt
tataaagtaaaagatgtaaacggcttccgcggcgggccggcgtattacatggaaaaaggg
ctgaacaaaaggtggatgggcgcgctgttcgctgtgttaatcaccttatcgttcggtatc
gtcttcaactcggttcaatccaatacagtcagccttgcctttgaaaacgcgtttggcaca
aaccgcctgacattgggactcattttaattgctgtattcggcacgattatttttggcgga
gtcaagcgcattgcaaagctggctgaatccattgtcgtcgtattggctgtcctgtatatc
ggagttgcgtttttcgtcattttctccaacattacgcagctgccaggtgtgcttgcgcta
atcgtgaaaaatgcgtttggttttgaccaggccgccggcggggctttgggcgcggcactc
atgcaaggcgtcagacggggaatcttttcaaacgaagcgggaatgggaagcgcaccaaat
gccgctgccaccgccacaacaagccatcccgtcaaacaggggctgatccaagcttttggt
gtactgacagatacactggtcatttgtacaagcaccgcttttatcattctgttttcggat
gcctatcatactccgggtctgagcggaatcgccttgacacaagcctccctcagctcccat
gtcggatcatgggcatcaggctttctcgcgattctgattttgttattcggattctgtgct
ctaattggaaactattattatggcgaaaccaatatcggctttttgaacaaaagcaaaaaa
ctgatttttgtctaccgtatcggcgtgctggcaatgatcgtgtttggctgtgttgccaaa
gtccagctcgtctgggatcttgctgatttgttcatgggtttgatggtcatcgtgaattta
atcgcgattttcttactatcaaaggtcgtttttacggcgctgaaagactatacacgccag
aaaaaagcaggcaaggatccggtcttttataaagatgtgctcaaaaaccataatggcatt
gagtgctggccggtttcagacacaaagactgacacgcacaacaaacaaatatcataa

DBGET integrated database retrieval system