KEGG   Bacillus subtilis subsp. subtilis 168: BSU02430Help
Entry
BSU02430          CDS       T00010                                 

Gene name
ybgJ
Definition
(RefSeq) glutaminase 1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00471  D-Glutamine and D-glutamate metabolism
bsu01100  Metabolic pathways
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU02430 (ybgJ)
   00220 Arginine biosynthesis
    BSU02430 (ybgJ)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU02430 (ybgJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU02430 (ybgJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BSU02430 (ybgJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 938416
NCBI-ProteinID: NP_388125
Pasteur: BG12753
BSORF: BG12753
UniProt: O31465
Structure
PDB: 

Position
complement(264191..265174)
Genome map
AA seq 327 aa AA seqDB search
MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVNDSQLGICVLEPDGTM
IHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRHEQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgataaaagagcaccagaaagacataaacccggcgttacagcttcatgat
tgggttgaatactatcgcccttttgccgccaatggacaaagcgcaaactatatccccgct
ttaggaaaagtcaatgattcacagctcggcatctgtgtattggagcctgatggaacgatg
atacacgccggcgactggaacgtctcttttaccatgcaaagcatttcaaaagtgattagc
tttattgccgcctgcatgagccgcggcattccctatgtgcttgaccgcgtagatgtcgag
ccgacaggtgacgcctttaattcaatcattcggctcgaaatcaacaagccgggaaagccc
ttcaatcccatgatcaacgcgggtgccctcaccatcgcttcgatccttcccggagaatct
gcatacgaaaagctcgagtttctttactcggtgatggaaactttgataggaaaacggcca
agaattcatgaagaagtattccgttctgaatgggaaaccgcccaccgcaacagagcgctg
gcctactatttaaaagaaacaaactttttagaagctgaagtagaagaaacacttgaggtg
tacttgaagcaatgcgctatggagagcactacagaagatattgcgttgatcggcctgatc
cttgctcatgacgggtatcatccgattcgacacgagcaggtgattccaaaagatgtggca
aaattggccaaggcattaatgctgacgtgcggcatgtacaacgcttcaggcaaatatgcg
gcgtttgtcggcgtgccggccaaaagcggcgtctccggcggcatcatggcgctggtgcct
ccaagcgccagaagagaacagccttttcaatccggatgcggcatcggcatttacgggcct
gccattgatgaatacggcaacagcctcactggcggtatgctgctgaagcatatggcgcag
gaatgggagctcagcattttttaa

DBGET integrated database retrieval system