KEGG   Bacillus subtilis subsp. subtilis 168: BSU02430
Entry
BSU02430          CDS       T00010                                 

Gene name
ybgJ
Definition
(RefSeq) glutaminase 1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00471  D-Glutamine and D-glutamate metabolism
bsu01100  Metabolic pathways
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU02430 (ybgJ)
   00220 Arginine biosynthesis
    BSU02430 (ybgJ)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU02430 (ybgJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02430 (ybgJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BSU02430 (ybgJ)
SSDB
Motif
Pfam: Glutaminase
Other DBs
NCBI-GeneID: 938416
NCBI-ProteinID: NP_388125
Pasteur: BG12753
BSORF: BG12753
UniProt: O31465 A0A6M3Z7H7
Structure
PDB: 
1MKI 3BRM 2OSU 3AGF

Position
complement(264191..265174)
AA seq 327 aa
MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVNDSQLGICVLEPDGTM
IHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRHEQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaaagaattgataaaagagcaccagaaagacataaacccggcgttacagcttcatgat
tgggttgaatactatcgcccttttgccgccaatggacaaagcgcaaactatatccccgct
ttaggaaaagtcaatgattcacagctcggcatctgtgtattggagcctgatggaacgatg
atacacgccggcgactggaacgtctcttttaccatgcaaagcatttcaaaagtgattagc
tttattgccgcctgcatgagccgcggcattccctatgtgcttgaccgcgtagatgtcgag
ccgacaggtgacgcctttaattcaatcattcggctcgaaatcaacaagccgggaaagccc
ttcaatcccatgatcaacgcgggtgccctcaccatcgcttcgatccttcccggagaatct
gcatacgaaaagctcgagtttctttactcggtgatggaaactttgataggaaaacggcca
agaattcatgaagaagtattccgttctgaatgggaaaccgcccaccgcaacagagcgctg
gcctactatttaaaagaaacaaactttttagaagctgaagtagaagaaacacttgaggtg
tacttgaagcaatgcgctatggagagcactacagaagatattgcgttgatcggcctgatc
cttgctcatgacgggtatcatccgattcgacacgagcaggtgattccaaaagatgtggca
aaattggccaaggcattaatgctgacgtgcggcatgtacaacgcttcaggcaaatatgcg
gcgtttgtcggcgtgccggccaaaagcggcgtctccggcggcatcatggcgctggtgcct
ccaagcgccagaagagaacagccttttcaatccggatgcggcatcggcatttacgggcct
gccattgatgaatacggcaacagcctcactggcggtatgctgctgaagcatatggcgcag
gaatgggagctcagcattttttaa

DBGET integrated database retrieval system