KEGG   Bacillus subtilis subsp. subtilis 168: BSU02440
Entry
BSU02440          CDS       T00010                                 

Symbol
glnJ
Name
(RefSeq) sensor histidine kinase
  KO
K07717  two-component system, sensor histidine kinase GlnK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02440 (glnJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU02440 (glnJ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02440 (glnJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU02440 (glnJ)
Protein kinases [BR:bsu01001]
 Histidine kinases
  Other
   BSU02440 (glnJ)
Two-component system [BR:bsu02022]
 Other families
  GlnK-GlnL (glutamine utilization)
   BSU02440 (glnJ)
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HATPase_c_3 DUF4431 CP_ATPgrasp_1
Other DBs
NCBI-GeneID: 938417
NCBI-ProteinID: NP_388126
Pasteur: BG10871
BSORF: BG10871
UniProt: P40758 A0A6M3ZM11
Position
265476..266708
AA seq 410 aa
MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPGFLTGAAVFIFRVFLE
LWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIMLGFIGFMIEVVSDCVE
LTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYETQSREKQTRQQHEHMLMI
VSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGRILRLAGEIHEVKKDNQRI
FAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQIDFYCSIEGEHDEYHVFIVL
SIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNGPGISEKIGDIVFDPGFTSKY
DEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAIRLPVRHLIQKG
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgctgattacggtgccgctggccggtgaactgaaattttatcccctcaatgaagaattc
cgggtcagctttggggcaccggtttttttcttctttttatcattgttgcggcatgtgccc
gctgtgctgccgggttttctgactggagcggctgttttcatctttcgcgtctttctggaa
ttatggggcggaggacacaatgggctgactccgattctgtatgatcaagcgtctggcttt
ttcttttatatgacttacgcctgtctgttttccatattaaaggccaatcgtttccgtgaa
cggccgattatgctcggtttcattgggtttatgattgaagttgtgtcagattgtgtcgag
ctaactgtgcaatttctcatttttcatacggttgtcacgcctgagaaaatcactgacatt
gcggtgattgcgatttctcacacatttattgtgatgagcttttatagtgtgctgaagctg
tatgaaacacaatcgagagaaaaacagacaaggcagcagcacgagcacatgctgatgatc
gtttccaatttatatgaagaaacggtgcacctaaaaaagacattgaaaacgacagagaaa
gtgacaaacgattcgtatcagctctatcgggaaatgaagggcaaggatgttcagctgagc
ggcagaatcctgagactggccggagagattcatgaagtgaaaaaggacaaccagcggata
ttcgcagggctttcaaaactgatttcgaatgagagtttgagagattatatgagggcttct
gatttgctgcagctcgtgattcgaatgaatgaaaagtacgctgaagcactagggaagcag
attgatttttactgctcgatcgagggagagcatgacgaatatcacgtatttatcgtgctt
tcgatcattaataatctaacagcaaatgcggtagaggctatggatgaagagggaatggtc
agcctgaggctccgtaagccaaatgagagtatggtagaattccaggtggaagacaatggc
cccgggatttccgagaaaatcggagacattgtgtttgacccgggctttacttcaaaatat
gacgaatttggcacgccttctacgggtatcggactttcctacgtaaaggaaatcgtgaca
gagctagaaggggatatcacgtttgataatcagcagcggggagtggtgtttgccatcagg
ctgcctgtccggcatttgattcagaaagggtga

DBGET integrated database retrieval system