KEGG   Bacillus subtilis subsp. subtilis 168: BSU02450
Entry
BSU02450          CDS       T00010                                 

Symbol
glnL
Name
(RefSeq) transcriptional regulatory protein GlnL
  KO
K07719  two-component system, response regulator GlnL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02450 (glnL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02450 (glnL)
Two-component system [BR:bsu02022]
 Other families
  GlnK-GlnL (glutamine utilization)
   BSU02450 (glnL)
SSDB
Motif
Pfam: YcbB Response_reg
Other DBs
NCBI-GeneID: 938414
NCBI-ProteinID: NP_388127
Pasteur: BG10872
BSORF: BG10872
UniProt: P40759 A0A6M4JJN7
Position
266719..267663
AA seq 314 aa
MRFFIADDDRAVRSILRQIIEDEDLGEAAGEADDGSQVEGHMLQFKQIDILLIDLLMPGR
DGIETIRQIQNTYSGKIVMISQVEAKEMVGEAYSLGIEYFIHKPINRIEIVTVLQKVKER
IELEHSIGAIQHSLSRLVNRTERKARPQQKSDSGLKEAGTFLLSELGMMGEGGAHDLMAV
LQYLAEHEQSEPHEKQSPSLKQIFTQVAVRKLGTGASQTEVNREMKASEQRIRRAIIHSL
HHFASLGTTDFSNPKFETYASKFFDFPVVSQKMKELQSKDAKPLAPARINMKKFIHVFFL
EAKLLHETMKQRRI
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcgtttttttattgcagatgatgaccgtgcggtgcggtcaattttaaggcagatcatt
gaggacgaagatctcggggaagctgctggtgaagcagacgacggaagccaagtggaaggg
catatgctgcaatttaagcagattgatattttattaatcgatctgttaatgcccggaaga
gacggcattgagacgattcgtcagatccagaatacgtactccggcaaaatcgtaatgatc
tctcaagtggaggcgaaggaaatggtcggggaagcgtactcgctcggcatcgaatatttt
atccataagccgattaaccgcattgaaattgtcacggttctccaaaaggtgaaggagcgg
atcgagcttgaacactcgattggagccattcagcattctctaagccggcttgtcaatcgg
actgaacggaaagcgcgtccccagcagaagagtgacagcggtttaaaagaggcaggaaca
ttcctgttgtccgagctgggcatgatgggagaaggcggcgcacatgatctcatggcggtc
ctgcagtatttagcagaacacgagcaatccgagccgcacgaaaaacaaagcccttcgcta
aaacaaatattcacccaagtagcggtacggaagctggggacaggagcctcacagacggaa
gtcaatcgcgaaatgaaagcctcggagcagcgtatccgcagagcgattattcattcgctg
caccattttgcttcactgggcacaactgatttttcgaatccaaaatttgaaacctatgca
tcgaaattctttgattttccggttgtcagccagaaaatgaaagaactccaatccaaggat
gcaaaaccccttgcacctgctagaataaatatgaaaaaattcatccacgtgttttttttg
gaagcaaagcttttgcatgagacgatgaaacaaagaaggatataa

DBGET integrated database retrieval system