KEGG   Bacillus subtilis subsp. subtilis 168: BSU02460
Entry
BSU02460          CDS       T00010                                 

Gene name
ycbC
Definition
(RefSeq) 5-dehydro-4-deoxyglucarate dehydratase
  KO
K01707  5-dehydro-4-deoxyglucarate dehydratase [EC:4.2.1.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00053  Ascorbate and aldarate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BSU02460 (ycbC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.41  5-dehydro-4-deoxyglucarate dehydratase
     BSU02460 (ycbC)
SSDB
Motif
Pfam: DHDPS SidE_DUB
Other DBs
NCBI-GeneID: 938409
NCBI-ProteinID: NP_388128
Pasteur: BG11158
BSORF: BG11158
UniProt: P42235 A0A6M4JI46
Position
267890..268816
AA seq 308 aa
MSRIRKAPAGILGFPVAPFNTQGKLEEEALFQNIEFLLNEGLEAIFIACGSGEFQSLSQK
EYEQMVEVAVSAAGGKVPVYTGVGGNLSTALDWAQLSEKKGADGYLILPPYLVHGEQEGL
YQYAKTIIESTDLNAILYQRDNAVLSVEQIKRLTECEQLVGVKDGVGNMDLNINLVYTIG
DRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMFYDALKNGNDELVKELYRH
VILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGPVEKDHYQQLEAILKQAADR
FPKKAATV
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagccgtatcagaaaagcacccgctggaattttaggttttccggttgctccttttaac
acacaaggaaaactggaggaagaagctctttttcaaaacattgagtttttgctgaatgag
ggcttggaagcgatatttatcgcttgcgggtctggtgaattccaatctctcagccagaag
gaatatgagcaaatggtggaagtcgcagtctcggcagccggaggaaaggtgccggtctac
acgggggtgggcggcaacctcagcacagcgcttgattgggcgcagctgtcggagaaaaaa
ggcgccgacggctacttgattctgcctccgtatttggtgcatggcgaacaggaggggctg
taccagtatgcgaaaacgattattgaaagcactgacttgaacgcgattctttatcagcgc
gataacgcagttctctctgttgaacagatcaaacgtctgaccgaatgtgaacagcttgtc
ggtgtcaaagacggggtaggaaatatggatttgaatatcaatctcgtctatacgatcggc
gaccgcttgggatggctcaacggaatgccgatggctgaagtgacgatgccggcttatctg
ccgatcgggttccactcttactcttcagcgatttcaaattatatcccgcatatttcgcga
atgttctatgatgcattgaaaaacggaaatgacgagcttgtgaaggaactctatcggcat
gtgattctgccgatcaacgacattcgcaaacaacgaaaaggctacgccgtatccttgatt
aaagccggtatggaaatcatgggtttgaatgtaaggaatacagccagaccgcctgtcggc
ccggttgaaaaagatcattatcagcaattggaagcaattttgaagcaggcggctgaccgt
tttccgaaaaaagccgcgacggtttga

DBGET integrated database retrieval system