KEGG   Bacillus subtilis subsp. subtilis 168: BSU02480
Entry
BSU02480          CDS       T00010                                 

Symbol
gudP
Name
(RefSeq) glucarate transporter
  KO
K03535  MFS transporter, ACS family, glucarate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02480 (gudP)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    BSU02480 (gudP)
SSDB
Motif
Pfam: MFS_1 Sugar_tr OATP DUF6019
Other DBs
NCBI-GeneID: 938413
NCBI-ProteinID: NP_388130
Pasteur: BG11160
BSORF: BG11160
UniProt: P42237 A0A6M3Z709
Position
270396..271763
AA seq 455 aa
MKKDFASVTPAGKKTSVRWFIVFMLFLVTSINYADRATLSITGDSVQHDLGLDSVAMGYV
FSAFGWAYVIGQLPGGWLLDRFGSKTIIALSIFFWSFFTLLQGAIGFFSAGTAIILLFAL
RFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAIVIFSPLMGWLTHSFGWH
SVFVVMGIAGILLAVIWLKTVYEPKKHPKVNEAELAYIEQGGGLISMDDSKSKQETESKW
PYIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQARGMSILEAGFVASLPALCGF
AGGVLGGIVSDILLKKGRSLTFARKVPIIAGMLLSCSMIVCNYTDSAWLVVVIMSLAFFG
KGFGALGWAVVSDTSPKECAGLSGGLFNTFGNIASITTPIIIGYIVNATGSFNGALVFVG
ANAIAAILSYLLLVGPIKRVVLKKQEQDPDQSLPV
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaaaaaagactttgcgagtgttactccggcgggcaaaaaaacgtccgtgcgctggttc
atcgtgtttatgctgtttcttgtgacctctattaactacgcggatcgagcgacgctttcc
atcaccggagattccgtccagcacgatttgggattggactcggtcgccatgggatatgtc
ttttctgcctttggctgggcctatgtcatcggacagcttccgggcggctggctgctggac
cgttttggttcaaagactatcattgcgttaagcatctttttctggtcgttttttacgttg
ctgcaaggggcgattggctttttctccgccggcacagcgattatcctgctgtttgcactg
cgttttctggttggtttatcagaagcgccttcatttcccggaaacggcagagttgttgcc
tcatggtttccaagctccgagcgcgggacagcttcagccttttttaattcagcacaatac
ttcgcaatcgtcattttttctcctttaatgggctggcttacccactctttcggctggcat
tccgttttcgttgtcatgggtattgcaggcattcttctggctgtcatctggctaaaaacg
gtgtatgaaccgaaaaaacatccgaaggttaatgaagctgagcttgcgtacatcgaacag
ggcggcgggctgatttccatggatgacagtaaaagcaaacaagaaacagaatcgaaatgg
ccgtatatcaaacagctgttaacgaaccgcatgctgattggcgtgtacatcgcgcaatac
tgtattacgactctcacctatttctttctcacatggtttccggtatatttggttcaggcc
cgcggcatgtctattcttgaagctgggtttgtcgcttccctgccggcgctgtgcggattt
gccggcggcgtgcttgggggcattgtgtcagacatcttactcaaaaaaggccgttcactg
acctttgcaagaaaagtgccaatcattgccggcatgctgctgtcttgcagtatgattgtc
tgtaactacacagattcagcatggctcgtcgttgtcattatgtcgctcgcgtttttcgga
aaaggcttcggcgcattgggttgggctgtcgtgtcggacacgtctccgaaagaatgtgca
ggattaagcggcggtttgttcaacactttcgggaatattgcctcaattacaacaccgatt
attatcggatacattgtcaatgccactggatctttcaatggcgcgcttgtgtttgtcggc
gctaacgcgattgcggcgatcctcagctatttgctgctggtcgggccgatcaaacgggtc
gtgttaaagaaacaagaacaagaccccgatcaatcgttgcctgtctaa

DBGET integrated database retrieval system