KEGG   Bacillus subtilis subsp. subtilis 168: BSU02490
Entry
BSU02490          CDS       T00010                                 

Symbol
gudD
Name
(RefSeq) glucarate dehydratase
  KO
K01706  glucarate dehydratase [EC:4.2.1.40]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00053  Ascorbate and aldarate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BSU02490 (gudD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.40  glucarate dehydratase
     BSU02490 (gudD)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-GeneID: 938410
NCBI-ProteinID: NP_388131
Pasteur: BG11161
BSORF: BG11161
UniProt: P42238 A0A6M3Z6X8
Position
271800..273167
AA seq 455 aa
MSSPIQEQVQKEKRSNIPSISEMKVIPVAGHDSMLLNLSGAHSPFFTRNIVILTDSSGNQ
GVGEVPGGEHIRRTLELSEPLVVGKSIGAYQAILQTVRKQFGDQDRGGRGNQTFDLRTTV
HAVTALEAALLDLLGKFLQEPVAALLGEGKQRDEVKMLGYLFYIGDRNRTTLPYQSDEQS
DCAWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLRGEEEIEAVTALSKRFPEA
RITLDPNGAWSLEEAIALCKGKQDVLAYAEDPCGDENGYSAREVMAEFRRATGLPTATNM
IATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCHDWGLTWGSHSNNHFDISLAM
FTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISSGCVKVPDKPGLGVDIDMEQVEKAH
EIYRKMNLGARNDAIPMQFLISNWEFDRKRPCLVR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagttcaccgatacaagagcaggttcaaaaagaaaaaagatcgaatattccctcaatt
tctgaaatgaaggtgattcctgttgcgggacatgacagcatgctgctgaatctaagcgga
gcacacagcccgttttttacccggaatatcgtaatcttaacagacagcagcggaaatcag
ggagtcggcgaggtgcctggcggagagcatattcgccgcacactggagctgtcagagccg
cttgttgtcggaaaatctatcggtgcgtaccaggcgatattgcaaacggtcagaaagcag
tttggcgatcaggacaggggagggcgaggaaaccagacgtttgatttgcgcaccactgtg
cacgccgtcaccgcactggaagcggctttgttggatttgcttggaaagtttcttcaggaa
ccggtcgcggctttgctgggcgaagggaagcagcgtgatgaagtaaaaatgctcggttac
ctcttttacatcggcgaccgaaatcggacgaccttgccgtatcaaagcgatgagcagtca
gattgtgcgtggttccgtctgcgccatgaggaagcgctgacgccggaggccattgtgcgt
cttgccgaatccgcacaggagcgctatggctttcaggatttcaaattgaaaggcggggtg
ctgcggggagaagaggaaatcgaagctgttaccgcattatcgaaacgttttccagaggca
aggatcactcttgatccgaacggggcatggtcattagaggaagctattgcattatgcaaa
ggaaagcaagatgtgctcgcgtatgcggaagatccatgcggggatgagaatggctactcc
gctcgtgaagtaatggctgaattccgccgcgcgacagggcttccgactgcgacaaatatg
attgcgactgactggcgggaaatgggtcacgcgattcagctccacgcggtcgatataccg
ctggctgatccgcatttttggacgatgcaagggtcggtgcgggttgcgcaaatgtgccat
gattggggtttgacatggggctcgcactccaacaaccactttgatatttcccttgcgatg
tttacccatgtggcagcagcggctccggggcggatcacggcgattgatacccattggatc
tggcaggacgggcagcgattaacgaaacagccttttgagatttcttctggctgtgtcaag
gtgccggataagcctggactaggcgtcgatattgatatggaacaagtggaaaaagcgcat
gagatctatcggaaaatgaatttaggcgcacggaatgatgcgatcccaatgcagttcctg
atcagcaactgggaatttgaccggaagcgcccgtgtcttgtgcgataa

DBGET integrated database retrieval system