KEGG   Bacillus subtilis subsp. subtilis 168: BSU02500Help
Entry
BSU02500          CDS       T00010                                 

Gene name
ycbG
Definition
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR FadR_C HTH_41 HTH_5 DUF4423 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 938411
NCBI-ProteinID: NP_388132
Pasteur: BG11162
BSORF: BG11162
UniProt: P42239
Position
273237..273938
Genome map
AA seq 233 aa AA seqDB search
MYEGLEDLKVDTVNRKTLAKQVIERIVHLLSSGQLRAGDKLPTEMELMDILHVSRPVLRE
ALSSLETLGVITRKTRGGTYFNDKIGMQPFSVMLALATDNLPAIIEARMALELGLVTIAA
EKINEEELQRLQKTIDDIANSTDNHYGEADKEFHRIIALSANNPVVEGMIQSLLITHAKI
DSQIPYRERDVTVEYHKKIYDALAKRDPYKAHYHMYEHLKFVRDKILKGMDEK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtttagaggatttgaaagtcgatacagtcaatcggaaaacattagccaag
caggtcatcgaacggattgtccatttattatcgagcggacagttgagggccggagacaaa
ttgccgacagaaatggaactgatggacattttgcatgtcagcaggccggtgctacgggaa
gcactcagttcacttgaaacgctgggcgtcattacgagaaaaacacgagggggcacatat
ttcaacgataaaatcggcatgcagccattttccgtcatgcttgctttggccactgataat
cttccggctatcattgaagcgcggatggcgctagaactcgggctcgtgacaattgccgcg
gaaaaaatcaatgaggaagagcttcagcgtttgcagaagacgatcgacgatattgccaac
agcactgacaatcattatggtgaagcggataaagagttccatcgaattattgcgttaagc
gccaataaccccgtcgttgaagggatgattcagtccctgctgatcacccatgcgaaaatt
gacagccaaattccgtacagggagagagatgtaacggtcgaatatcacaaaaaaatctac
gacgcccttgccaaaagagatccgtacaaagcacattaccacatgtatgagcatctgaaa
tttgtccgtgacaaaattctaaaaggaatggatgaaaaataa

DBGET integrated database retrieval system