KEGG   Bacillus subtilis subsp. subtilis 168: BSU02500
Entry
BSU02500          CDS       T00010                                 

Symbol
ycbG
Name
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GntR FCD FadR_C HTH_41 HTH_5 PDS5 HTH_Crp_2 DUF4423 HTH_11 MarR_2
Other DBs
NCBI-GeneID: 938411
NCBI-ProteinID: NP_388132
Pasteur: BG11162
BSORF: BG11162
UniProt: P42239 A0A6M4JEJ1
Position
273237..273938
AA seq 233 aa
MYEGLEDLKVDTVNRKTLAKQVIERIVHLLSSGQLRAGDKLPTEMELMDILHVSRPVLRE
ALSSLETLGVITRKTRGGTYFNDKIGMQPFSVMLALATDNLPAIIEARMALELGLVTIAA
EKINEEELQRLQKTIDDIANSTDNHYGEADKEFHRIIALSANNPVVEGMIQSLLITHAKI
DSQIPYRERDVTVEYHKKIYDALAKRDPYKAHYHMYEHLKFVRDKILKGMDEK
NT seq 702 nt   +upstreamnt  +downstreamnt
gtgtacgaaggtttagaggatttgaaagtcgatacagtcaatcggaaaacattagccaag
caggtcatcgaacggattgtccatttattatcgagcggacagttgagggccggagacaaa
ttgccgacagaaatggaactgatggacattttgcatgtcagcaggccggtgctacgggaa
gcactcagttcacttgaaacgctgggcgtcattacgagaaaaacacgagggggcacatat
ttcaacgataaaatcggcatgcagccattttccgtcatgcttgctttggccactgataat
cttccggctatcattgaagcgcggatggcgctagaactcgggctcgtgacaattgccgcg
gaaaaaatcaatgaggaagagcttcagcgtttgcagaagacgatcgacgatattgccaac
agcactgacaatcattatggtgaagcggataaagagttccatcgaattattgcgttaagc
gccaataaccccgtcgttgaagggatgattcagtccctgctgatcacccatgcgaaaatt
gacagccaaattccgtacagggagagagatgtaacggtcgaatatcacaaaaaaatctac
gacgcccttgccaaaagagatccgtacaaagcacattaccacatgtatgagcatctgaaa
tttgtccgtgacaaaattctaaaaggaatggatgaaaaataa

DBGET integrated database retrieval system