KEGG   Bacillus subtilis subsp. subtilis 168: BSU02510Help
Entry
BSU02510          CDS       T00010                                 

Gene name
garD
Definition
(RefSeq) D-galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BSU02510 (garD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     BSU02510 (garD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-GeneID: 938407
NCBI-ProteinID: NP_388133
Pasteur: BG11163
BSORF: BG11163
UniProt: P42240
Position
274029..275561
Genome map
AA seq 510 aa AA seqDB search
MAMNLRKNQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSCGLVLEEDVPQGHKVALTDLNQ
GDEIVRYGEVIGFADETIKRGSWIREALVRMPAPPALDDLPLANRVPQPRPPLEGYTFEG
YRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYPNVDDVVPLHHQYGCGVA
INAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERIASENDDDILSLQDHRGFAA
MIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAFSGVTANPAVGYAADLLVRA
GATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLIKEMKWYDSYLRRGDADRSANPSPGNKK
GGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLLFAATPASDFVCGTLQLAAGMNL
QVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDINAGRIATGEASIEDVGWEIFRTI
LDVASGRKQTWADRWGLHNDLCLFNPAPVT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaacctcaggaagaaccaagcccccctttacatcaaagtgcatgaaatagat
aacaccgcgattattgtaaatgatggagggctgccaaagggcactgttttctcatgcggg
ctcgtacttgaagaggatgttcctcaaggccataaggtggccctcaccgatctcaatcaa
ggggacgagatcgtgcgttacggagaggtgatcggatttgctgatgagacgatcaaacgc
gggagctggatacgggaagccctcgtgagaatgcccgctcctccggcgttagacgatctt
cctctcgcaaacagggtgccgcagccgcggcccccacttgaaggatatacatttgaagga
taccgaaatgcggatggcagtgcggggacaaaaaatatcctcggcatcacgacaagtgtt
caatgtgttgttggcgttttggattatgcagtcaaacgaataaaagaagagctgctgccg
aaatacccaaatgtcgatgacgttgtgccgctgcatcatcaatacggatgcggcgtggcg
atcaatgcgcccgacgctgtcattccgatccgcacgattcaaaatcttgcgaagcatccg
aacttcggcggtgaagtaatggtaatcggattgggatgtgaaaagctcctcccggaaaga
attgcctccgaaaatgatgatgacattctatcgctccaggatcaccgaggttttgcggcg
atgatccaatccattttggaaatggcggaggaacggttaatcaggctgaacagcagaacc
cgggtgtcatgccctgtttcggatctggttatcggcctgcaatgcggcggcagtgatgcg
ttttccggcgtgacggcgaaccctgccgtggggtatgcggctgatttattggttcgcgca
ggtgcaacggttttgttttctgaagtgacagaggtgcgggatgccattcatttattaacg
ccgcgggctgtcagtgaagaggtcggacaatcgctgatcaaagagatgaagtggtatgac
agctatcttcggcggggagacgcagaccgtagcgcaaacccgtcaccaggcaataaaaaa
ggcggattatccaatgtggtggaaaaagcgttaggttcggtagcgaaatcaggcacaagc
cccatctccggcgtgctcggccctggtgaaagagcaaagcaaaaaggcctgctgttcgcg
gcgacaccggcaagcgattttgtgtgcggcaccctgcagctggctgcgggcatgaatttg
caggtgtttacgacagggagaggaacaccatatggcctggctgctgcgccggttctgaaa
gtatcgacgcggcattccttatcagagcattgggctgatttaatcgatatcaatgccggc
cgaatcgcgacaggagaggccagtatcgaagacgtaggctgggaaatcttcaggacgatt
ttggatgtggcaagcggccgcaaacaaacgtgggcagaccgttggggtcttcataatgat
ttgtgcttgtttaatcctgctccagtgacttga

DBGET integrated database retrieval system