KEGG   Bacillus subtilis subsp. subtilis 168: BSU02520
Entry
BSU02520          CDS       T00010                                 

Symbol
ycbJ
Name
(RefSeq) hypothetical protein
  KO
K06979  macrolide phosphotransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU02520 (ycbJ)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Macrolide resistance genes
   Others
    BSU02520 (ycbJ)
SSDB
Motif
Pfam: APH TCAD9
Other DBs
NCBI-GeneID: 938408
NCBI-ProteinID: NP_388134
Pasteur: BG11165
BSORF: BG11165
UniProt: P42242 A0A6M4JF26
Position
275838..276758
AA seq 306 aa
MTNLNEKQLITEIVGLARSQGLTVHSENAQLNETGMDFQVVFAKDDTGMPWVLRKPRRSD
VVERASAEGITLAFLRANLTADVPDWRIHTPELIAYPMLKGTPAAGIDLEQKQYVWNMDH
QPPSDDFVRTLADILAELHGTDQISAGQSGIEVIRPEDFRQMTADSMVDVKNKLGVSTTL
WERWQKWVDDDAYWPGFSSLIHGDLHPPHILIDQNGRVTGLLDWTEAKVADPAKDFVLYQ
TIFGEKETARLLEYYDQAGGRIWAKMQEHISEMQAAYPVEIAKLALQTQQEEHINMALEA
LGVTSD
NT seq 921 nt   +upstreamnt  +downstreamnt
atgacaaaccttaacgaaaaacagcttatcactgagattgtcgggcttgcacgcagccaa
ggtttgacggttcattctgagaacgcgcaattgaatgaaaccggaatggactttcaagtt
gtatttgccaaggacgacacaggtatgccatgggtgctgcgaaaaccgcggcgaagtgat
gttgtggaaagagcatctgcagaaggcataacgcttgcctttctccgcgcgaatctgact
gctgatgtgccggattggagaattcatacaccggaattgatcgcttaccccatgttaaaa
ggaacgccggctgctggaattgacttggaacaaaagcaatatgtatggaatatggatcat
cagccgccgtcagacgactttgtccgcacacttgccgacatactggctgaattacatggc
acggatcaaatatctgctgggcaatccggaatagaagtgataaggccagaagatttcagg
caaatgacagcagactctatggttgatgtgaagaataagcttggcgtatctacgacgctt
tgggaaagatggcaaaagtgggtagatgatgatgcatactggccgggtttctcttctttg
atacacggcgatctccacccgccgcatatccttatcgatcaaaatggacgtgtcacagga
cttctggattggacagaagcgaaggttgctgacccagccaaggattttgttctttatcaa
accattttcggagaaaaagaaactgcccgtttgcttgaatactatgatcaagcaggcggc
cgaatatgggcaaaaatgcaggaacacatctcagagatgcaggcggcgtatccggtggaa
atcgccaagctagctctgcaaacacagcaggaggaacacatcaatatggcgctggaagca
cttggtgtaacatcggattaa

DBGET integrated database retrieval system