KEGG   Bacillus subtilis subsp. subtilis 168: BSU02540
Entry
BSU02540          CDS       T00010                                 

Symbol
ycbK
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 938405
NCBI-ProteinID: NP_388136
Pasteur: BG11166
BSORF: BG11166
UniProt: P42243 A0A6M3Z7I7
Position
277342..278280
AA seq 312 aa
MRAEEQSKIREAAAGTIFLLIGTVCFASKSIWIKWAYQMGAEPDAVLLYRQLLAVPLFWL
IFLIYRPPMPDGKKKGDLWKACGAGVFCFFLSPLLDFIGLNHVSAMVERILLMSYPLFVF
GFTACRDRKMSSIQDLFAVLAVMFGLFLALGGWNAELFQANMIGAVFILLSSAVYAGYLV
LSGHLVHQIGGIRLNAYGMTAAGAAMMLYTGIKSAAGMNTPMAAYPLSMYGLFAVIAVVT
TVIPFVLMLEGIKRIGAQRAAAISMAGPILTIFYGALFLGERLGLIQVIGCGGVFFVITG
MEYRKLKTGKKE
NT seq 939 nt   +upstreamnt  +downstreamnt
atgagagcagaagagcagagtaagattcgtgaggccgcagcaggtacgatttttttgctg
atcggaacagtttgttttgcgtctaaatcgatttggataaaatgggcataccaaatgggt
gctgagccagatgccgtgctgctatacaggcagctgctggctgttccgctgttttggctg
atttttttaatataccgtcctccaatgccagacggtaagaaaaaaggagacctatggaag
gcttgtggcgcgggagtgttttgtttttttctgtctcccttgcttgattttatcgggctg
aaccatgtatccgcaatggttgaacgtatattgctgatgagctatccgttgtttgtgttt
ggattcaccgcgtgtcgtgaccggaaaatgtcctcaattcaggaccttttcgcagttctg
gcggtcatgtttgggcttttcttggcgctgggcggctggaatgctgagcttttccaggcg
aatatgattggagctgtattcattttgttatcttcggccgtctatgctggttatcttgtc
ctttccgggcatctcgtccatcaaatcggagggatccgtctcaatgcatacgggatgaca
gctgctggagctgccatgatgctttacacagggataaaatcggcggctggcatgaatacg
ccaatggcagcatatccgctttctatgtatggtttgttcgcagtaattgcagtcgttacc
acagtgattccatttgtgctaatgcttgagggcataaaacgaatcggggcacagcgagcc
gccgccatttcaatggcagggcctatcctgacgattttctatggagctttatttctcggt
gaacggctcgggctcattcaagtcattggatgcggtggcgtattttttgtcattacgggc
atggaatacaggaagctgaaaacaggaaaaaaagaataa

DBGET integrated database retrieval system