KEGG   Bacillus subtilis subsp. subtilis 168: BSU02550
Entry
BSU02550          CDS       T00010                                 

Gene name
ycbL
Definition
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02550 (ycbL)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU02550 (ycbL)
Motif
Pfam: Trans_reg_C Response_reg
Other DBs
NCBI-GeneID: 938400
NCBI-ProteinID: NP_388137
Pasteur: BG11167
BSORF: BG11167
UniProt: P42244 A0A6M4JCU5
Position
278377..279057
AA seq 226 aa
MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLVLLDIMLPKLNGMDFL
KIIREKSNIPVLMISAKDGDVDKALGLGFGADDYIAKPFSMIELTARVKAAIRRATQYSA
EEPAVNKVIRIHQLAIDIDNVSVLKNGEPLQLTSTEWQLLCLFASNPKKVFTKEQIYRSV
WNEEYFDDQNIINVHMRRLREKIEDDPSSPQYIKTLWGIGYKLGEF
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgcttgtagaagacgaccactcaatcagtgaaatggtggatcattatttaacaaaagaa
ggctttggaattgtgcatgctttcgacggagaagagggcatccggctgtttcagcagggt
tcatacgatttggtcctccttgatatcatgctcccgaagctgaacggcatggattttctg
aaaatcatccgggaaaaaagcaatataccggtcttaatgatttcggcaaaagatggagat
gtggacaaggcattgggactgggctttggggcggatgattatatcgccaaaccgttttcg
atgattgagctgacagcccgagtaaaagccgcgatacggcgggcgacgcaatattcggca
gaggagccggctgtgaataaggtgatccggattcaccagcttgcgatagatatagacaat
gtttccgttttgaaaaacggagagccgctccagctgacgtcaacagaatggcagctgctg
tgcttatttgcatcaaatcctaaaaaagtgtttacgaaagaacaaatctaccgttccgtt
tggaatgaagagtactttgatgatcagaacatcattaacgtacatatgcggcggctcaga
gaaaagattgaggatgacccctcctcccctcaatatattaaaacgttatggggcatcggt
tataaattaggagagttttag

DBGET integrated database retrieval system