KEGG   Bacillus subtilis subsp. subtilis 168: BSU02580
Entry
BSU02580          CDS       T00010                                 

Symbol
ycbO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ABC2_membrane_4 ABC2_membrane_2
Other DBs
NCBI-GeneID: 938401
NCBI-ProteinID: NP_388140
Pasteur: BG11170
BSORF: BG11170
UniProt: P42247 A0A6M4JCF9
Position
281028..281714
AA seq 228 aa
MNLIRIELRKMKMGWYIRGALIANVIIMGFMWLISYSEKADGGVSFQSTDEAFLIIGTFV
RAVFIVFGAVLIVKLVISEYKNKTILVMFTYPISRKKLLTAKLMIAGGLTFITILLSNIL
IAAGFFWLNSICHFIPGELTSEIISQQAVKMAVFAFGAAGTSLVPIFFGMRRHSVPATII
SSVVIVMLISSTSPGFSISSVVYIPLSLAAFGLFFSYMAIRNADKQDA
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaatttgatcagaatcgaattaagaaaaatgaaaatgggctggtatatcagaggtgcc
ctcattgccaacgtgatcattatgggttttatgtggctgatcagttattccgaaaaagcc
gatggcggggtttcgttccaaagtacggatgaagcattcctcatcatcggcaccttcgtc
agagcggtatttatcgtatttggcgctgtgctgatcgtaaaattggtgatttcggaatat
aaaaacaaaaccattcttgtgatgttcacgtacccgatcagccgtaaaaagctgctcacc
gctaagctcatgatcgcgggcggactgacgtttatcacgattttactttcaaatatactc
atagccgccggtttcttttggctgaactcgatctgccatttcataccgggagagcttact
tccgagatcatttctcaacaggcggtcaaaatggcggttttcgcttttggcgccgctgga
accagtttagttcccatcttttttgggatgcgtagacactcggttccggcgaccatcatt
tcatctgtagtaattgtgatgctcatcagctcaacaagtccgggcttctcgatttcatct
gttgtgtatatcccgttatcgttagcggcattcggtttgttcttttcctacatggcgatc
aggaatgcggacaagcaggatgcgtaa

DBGET integrated database retrieval system