KEGG   Bacillus subtilis subsp. subtilis 168: BSU02590
Entry
BSU02590          CDS       T00010                                 

Symbol
ycbP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2512 Virul_fac_BrkB Phage_holin_4_2 DUF3021
Other DBs
NCBI-GeneID: 938402
NCBI-ProteinID: NP_388141
Pasteur: BG11171
BSORF: BG11171
UniProt: P42248 A0A6M3Z724
Position
complement(281769..282155)
AA seq 128 aa
MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI
ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH
YLETRTDS
NT seq 387 nt   +upstreamnt  +downstreamnt
atgacacatgtgaaagcgctcgctattaaaggtattatgacgattattgtgttgtatctg
gtgcttggtctgggctttggtttcacgtttggtgatacgctgctaatgacgattgtgtta
ggggttatttcttatttgctgggcgatctttatgtattgccgaaatggaataatatgatt
gcaactttggctgattttggtttggcctttctcgtgatctggctgatgggcatgccgctt
tctatggggatgactggcggtgaagttgcattggcggctttattcggcgcgatcgtcatg
gcaatcggtgaatattgcttccatttctatatgatgagcaaagagattggcaagaagcat
tatcttgaaacaagaacagactcataa

DBGET integrated database retrieval system