KEGG   Bacillus subtilis subsp. subtilis 168: BSU02600
Entry
BSU02600          CDS       T00010                                 

Symbol
cwlJ
Name
(RefSeq) cell wall hydrolase CwlJ
  KO
K01449  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU02600 (cwlJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU02600 (cwlJ)
SSDB
Motif
Pfam: Hydrolase_2
Other DBs
NCBI-GeneID: 938399
NCBI-ProteinID: NP_388142
Pasteur: BG11172
BSORF: BG11172
UniProt: P42249 A0A6M3Z6Z2
Position
282469..282897
AA seq 142 aa
MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANCSDFKGLRTIRQMIYQ
PHAFEAVTHGYFYQRARDSERALARRSINGERRWPAKFSLWYFRPQGDCPAQWYNQPFVA
RFKSHCFYQPTAETCENVYNTF
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggtcgtgagagcaacgagtgcggatgtcgatttgatggcaaggctgctcagagcg
gaagcggaaggcgaaggcaagcaggggatgctgcttgtcggcaacgttggaattaatcgg
ctgcgggcgaattgctcagattttaaaggcctccgcaccatcaggcagatgatttatcag
ccacacgcgtttgaggctgtgactcatggatatttttatcaaagggcgcgagatagcgag
cgtgcccttgcacgccggtcgattaatggtgaaaggcgctggcctgcaaaatttagttta
tggtacttcaggccgcagggggactgtccagcccagtggtataaccagccgtttgtggcc
agatttaagtcacactgcttttatcagccgacggcggagacgtgtgaaaatgtatataac
acattttag

DBGET integrated database retrieval system